ELF> 1@ @8@#"@@@PPPHHTTppp J J J GM   ppp00DD J J J Stdppp00Ptd> > > **QtdRtd J J J EE/lib64/ld-linux-x86-64.so.2 GNUGNU=~4yěhTGNUs@Ѓsy}>[ݣk`~ju)N<Ĺ@9M>   oQ(15,F" "fr /k9yX"   OG, ;["| _dB*u. Ph4aj Pb}2A:1'w! I !#( 0 X#u % _ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTable__pthread_key_create__cxa_finalizepthread_mutex_lockpthread_mutex_unlockgettextmallocmemmove__libc_start_mainfputcstrcmpfputsdl_iterate_phdrmemsetstrncmpmemchrpthread_oncestrlenmemcmpreallocsyscallabortstderrioctlmemcpy__libc_single_threaded__errno_locationfwrite__stack_chk_fail__cxa_atexit__tls_get_addrvsprintflseekstrchrstrtoulcalloc_obstack_beginsbrksetlocalebindtextdomainnl_langinfostrcasecmpfileno_unlockedisattygetenvfopenfseekftellfreadfcloseferrorstrtolobstack_alloc_failed_handlermkstempspipe2__environvforkexecvdup2execvpsleep_exitstrcpystrerroraccess_obstack_newchunkstrtoullpipestrrchr__isoc99_sscanfsysconf__isoc99_fscanffgets_obstack_freefeofstdoutputenvsnprintffflushfcntlstrnlenvfprintfgetpidkillstrcatunlinkstrsignalgetpagesizemmaplstatreadlinkfstatwaitpidwait4fdopenstrncpy_obstack_begin_1_obstack_allocated_p_obstack_memory_usedremovemunmaplibm.so.6libc.so.6ld-linux-x86-64.so.2GLIBC_2.3GLIBC_2.14GLIBC_2.4GLIBC_2.32GLIBC_2.33GLIBC_2.11GLIBC_2.34GLIBC_2.7GLIBC_2.2.5GLIBC_2.9_ITM_addUserCommitAction_ITM_memcpyRtWn_ITM_RU1_ZGTtdlPv_ITM_RU8_ITM_memcpyRnWt_ZGTtnam    ii 1  ;ii FP[fqii |ui ii  J 2(J 0J  8J 1@J @J `J VpJ ǶJ 9J 9J vJ iJ  wJ wK vK w@K wPK w`K +wpK 9wK yK DwK ͡K L IwL Rw@L VPL 9`L \wL awL kwL L swL }wL wL wL w M w0M `M VpM wM 9M ǶM dM wM wN w N w0N w`N wpN wN wN wN  xN xN AN xO #xO 9@O 9 PO : O 8O 'xO 5 O wO 2xO gP  P 9x0P Cx`P LxpP RxP WxP \xP exP 9P xQ ixQ ?w Q mx0Q @Q sxPQ wxQ xQ xQ xQ xR R x R @R xPR `R RwpR xR VR xR xR xR x S 0S 9@S x`S xpS xS xS xS VS xS 9S  T  y0T  y@T yPT y`T 7T pT 9T wT wT wT wT y U 3y0U y@U "yPU *y`U ypU /yU 7yU ΊU U  U ΊU ?y V {0V H@V HyPV Uy`V \ypV iyV vyV }yV VV V yW  W @W xwPW yW .W 5 W uW yW yX yX 9 X y@X .PX 5 `X uX  X yX yX 9X yX 9Y y Y 90Y y@Y y`Y pY yY yY yY yY (Y Y yY 9Z  Z 0Z z`Z pZ  Z  zZ zZ zZ BZ 4Z Z  [ z[ 0[  [  [ @@[ BH[ ~P[ X[ z`[ yh[ zp[ x[ Ǘ[ [ A[ [  [ {[ z[ [ J[ [ \ 4\  \ \ pA \ @(\ z0\ 8\ p)@\ H\ ΁`\ p\ Z \ \ '\  \ `Z \ \ .\ H\  Z \ 5\ <\ x] Y ] ] C ] 0] `Y @] H] J`]  Y p] Qx] X] ] X ] _] f] ] X ] m] t] @X ^ {^  ^ X 0^ 8^ P^ W `^ h^ ^ W ^ ^ ^ @W ^ ^ ^ W ^ ^ Ȫ_ V _ Ϫ(_ ֪8_ z@_  V P_ X_ ݪh_ @p_ U _ _ _ h_ U _ _ _ 2z_  U _ _ _ ` T ` ` (` Pz0` T @`  H` X` ``  T p` 0x` ` ` S ` @` ` X` `S ` P` ` `  S a `a a iz a R 0a p8a #Ha zPa R `a ha *xa a @R a a 1a (a R a a 8a pa Q a a ?b b Q b (b F8b z@b Q Pb Xb Mhb pb P b b Tb zb `P b b [b  P b b bc O c ic p(c 0c O @c Hc wPc X`c @O pc xc ~c c N c  c c c N c 0c c  c `N d @d d H d  N 0d  8d Hd xPd M `d Phd pd d M d `d d zd `M d pd d  M d d e e L e (e ī@e @L Pe ˫Xe ҫhe (pe K e e ٫e Pe K e e e ze @K e e e f J f f (f 0f J @f Hf Xf `f `J pf 0xf f {f {@g {g {h &{h /{`h K{ph /{h U{ i `{i u{i {i (@j {j {k {k {`k {pk {k { l {l {l {@m |m |n |`n &|n /| o @|o P|o a|@p n|p ||q |`q |hq |q |q p r |0r |r |r |r |r |@s |`s  9 s  }s  }t 7}t  }`t Q}pt  }t l}t  } u }u }u }@v }v }w }`w ~w .~ x E~0x |x P~x [~@y g~y {~z ~`z ~z ~ { ~{ ~{ ~@| |  } +} |`} 4} B} | ~ (~ (~ L~ x~ ~ @ H     ` 0h X Ȁ  x(   ( e @ H   0 X x` h  {ȃ P  (        @ H   8  `     ` p h   8 Ȇ `   (   8  h    @ H   4 P  ` Hh p ȉ  G( x     @ H @   e (` }h  Ȍ  x(    ( P@ xH      ` h  ȏ  ( @ x   @ PH x     H` h  Ȓ 0 π(    ( P@ H   8 x ` h 0 ȕ  ( 8      8! `!@ H ! " 8" " "`  #h @# #Ș # H$( p$ % (% % %@ &H 8& = `& & &`  'h P' 'ț ' (( H( ( ) X t@ H   Ӂ ) )` h )  *Ȟ H* ( * " * < *@ RH 8+ + + i +` ,h 8, x,ȡ , ,( - H- p- - -@ H.H x. / 0/ / /` h  0 h0Ȥ 0 ( 0  1 H1 p1@ ՂH 1 1 (2 `2 2` 2h 3 ȧ @3  ( 3 $ 3 3 4@ P4H p4 4 4 5 @5` 5h 5 6Ȫ 86 6( 6  7 H7 7 7@ 8H (8 A 8 8 9` _h X9 9ȭ 9 :( 8: x p: : :@ ;H H; ; ; (< P<` <h < =Ȱ  = p=( = = >  P>@ >H > ? (? ? ?` h  @ p@ȳ @ @( A xA A Ƀ A@ H 8B  pB B B` Ch 0C Cȶ C ( D hD D D D@ XEH E E F F F` XGh G Gȹ G 8H( XH H 0C I C@ 2H  I hI I I J` PJh xJ Nȼ J k( K  xJ XK K@ KH K   L xL L` h  M ۄȿ XM ( M  M N @N@ NH N 8O `O / O` Oh O J PP P( P 0Q XQ Q Q@ HRH hR g R R R` }h @S  S ( T ΅ HT  T@ TH T  (U  hU` 5h U N V HV( pV k V HW xW@ XH (X hX X  X`  Yh HY Y Y Z( (Z  XZ Z Z@ 0[H `[ [ [  \` `\h \ 8] `] ]( ] ] ^ ^ ^@ _H 8_ _ _ ` (`` h`h ` ` ` چ( Pa a a  0b@ H b " b pc c` dh Hd d d @( 8e e e e (f@ xfH f f g Pg g` gh h h h Hi( pi j (j hj j@  kH Hk k l Y hl` lh m Hm xm m( m `n n n o@ HoH ho u o o o` ph p  q @q q( q  8r Xr xr@ rH r 0s `s s s` Xth t  ‡ ͇ ߇@   `     1 0u@ J b t`    ƈ ڈ@ Xu  `      $@ 1 < F` Qh _ x   @   { ͉ {` ߉  s  |  |@ ,H xuP /{ / 2 5` Nh u R (v { U X v  } [ v@ ^H w b Pw f xw  }` ih w l o( r  w |  x |@ H @x  px  x |` h x  x (y ( Py0 (y  y @ Ɗ Ɋ y ̊ y` ӊh 0z ׊ pz ۊ( z ފ @   `     @      {` <h z ? z  T Y 0{ _ {@ iH { p H|  |` h |  }  H}( h}  } ċ }@ ԋH ~` Ƕh 9  `~  ` h ~ / X  <( E `  v (@ H h    (` h p nj  (  0 X  @ H  @ h Ѓ ` @h `  Є  (( H  Ѕ /  @ hH  F  0 `` `h     z( `    @ H   @  p ҍ @` h   ȉ   (  @ H p    1 @ EH  R  f  y( 9` sh (    ( ؋  0  x@ H  Ȏ ׎ ` h `       "@ 1H h B  S ` dh @ u   (     (@ H ` ȏ  ֏ Ȑ  ( p` h Ȑ   ( 0  ` # @! 6H! ! H! (" T" p`" fh" " p" { # (#  # # h# # @$ ɐH$ ؓ$ ܐ$ % % 8`% h% p% %  & !(& & 5& E& _& 8@' kH' p' ' ( ( `( h( (( đ( p ) ֑() ؖ) ) P) ) @* H* 0* * + + `+ 1h+ @+ N+  , e(, , s, , , 0@- H- p- - Ț. ƒ. `. ؒh. @. . x / (/ / / /  / @0 H0 &0 @0 h0 D1 r1 `1 bh1 1 o1   2 (2 H2 2 x2 2 @3 H3 3 3 04 ˓4 h 4 (4 p`4 ԓh4 4 4  5 (5 05  5 x5  5 6 6 p@6 2H6 06 E6 7 W7 ؠ`7 kh7 7 7 p7 7 x 8 (8 ȡ8 8 8 8 h@9 H9  9 Д9 p: : آ`: h: : : 0 ; .(; X; 4; ; E; @< ZH< < o< = z = 0x(= p`= h= @= h=  > (> > > > ͕>  @? ? ? X@ @ `@ h@ @ 6@ @ A K(A A WA ЦA `A @B qHB XB B C C `C hC (C ÖC h D Ԗ(D D D D D @@E HE xE &E F 9`F >F MF  G \(G 0G nG XG G Ȫ@H HH H H pI I `I ƗhI I ͗I 0 J (J hJ J J J `@K 'HK K <K L TL `L fhL L {L ` M (M M M دM @N ۘHN N N XO `O hO O .O  P @(P 0P UP _P `@Q kHQ Q Q R R `R řhR @R љR  S (S Ȳ@S HS 9S S 0S S 9S .S T T 9@T EHT `T hT 9T VT HT T 9U gU  U (U 9`U |hU U U h V (V V V V V 0@W ʚHW W ܚW yW 9X X ȶ`X hX X  X p Y (Y Y "Y 8Y 3Y h@Z KHZ Z bZ и[ p[ `[ {h[ H[ [  \ (\ й\ \ \ қ\ H@] ] ] x^ ^ `^ h^ ^ $^ @ _ -(_ _ ;_ _ F_ @` YH` P`` h` p` i` Pa za `a ha мa a  b (b 8b b xb Ӝb @c ݜHc ؽc c (d d x`d d d  e 2(e e De 0e Re p@f dHf f vf g g `g hg `g g  h (h h h h ̝h h@i ڝHi i i j j H`j  hj j  k 0(k k >k Mk @l gHl `l wl m m `m hm m m 8 n ˞(n `@n Hn pn ܞn `n n @o Ho o o p p @`p 1hp xp Ip  q \(q Xq qq q q (@r Hr hr r s s `s ͟hs s s 8 t (t ht  t ht t @u 0Hu u Hu (v Yv  v (v p`v mhv  v v  w (w w w hw w @x ٠Hx 8x x y y `y )hy  y Fy p z _(z z wz z z p@{ H{ { { | | H`| ġh| | ա|  } (} } } P} } @~ H~ ~ #~ ( 4 X` ;h  M  d(  p 0 | x@ H      P` h  ĢȂ  Ң( 8  x  @ H      8` 2h ` Eȅ ` a( ` ~   @ H     ȇ p ԣ  ` h H Ȉ p ( & C  [ @ kH  ~ @  ` h  ȋ  ¤( Ѥ  8  @ H     P` ,h x BȎ  H(  [  k @ vH   H  (` h ` ȑ  (  ե  @   ` {h  Ȕ 0   s  @ { ~ 0 F` Lh p Oȗ  Z(  g  u @ H (  ` {h h |Ț  |(   Ѧ@ ަ  `   ȝ P 3v(    * @ @H 8 O ` ` ` h  HȠ h s(    @ ƧH  ԧ  `  ȣ " < K   p Y (@ hH  }  ` h  Ȧ 0 Ǩ( ` ۨ  @ H    ( = H` eh ` ȩ  (    X x@ ©H  ٩   ` h 8 xȬ  !(  7 ` H `@ [H ` w `  ` h  ʪȯ X Ӫ(     h@ H     / H` ?h  KȲ  W( ` c  o @ H 0  h  ` h  ͫȵ X @( X  X @  + 5 S` ^h o xȸ ` (     0@ H  ɬ  ڬ ` h ( Hv y ( h   " x@ <H  N  Z `` qh ( zȾ h ( h  `  `@ H `  `  `` ӭh `  `  ( `  ` @ .H `  ` 8 `` `h ` B ` ( ` [ `  `@ oH  z   ` h X Ǯ  Ю    @ H    " ` @h X N  ^( X o    `@ H    ů (` ݯh x   ( P   x  @ -H  <  O X` ah 0 t p (     @ H 8 ΰ  ٰ ` ߰h   0 ( x   / @ EH @ N  T ` nh   H (    ı 0@ ұH `    `  h   P .(  B  R @ aH @ n x ~ ` h X   ( X ɲ 0 ݲ h@ H     ` h H /  H(  e  t @ H p  . u  ` ӳh     (  ! 8 p @ H  > 0 u ` Yh  r 0 ( p    @ H    8 `` ڴh    (  ' - E @ @ PH   \   g  ` sh    8  ( x       @ H   ʵ `  ڵ  `  h   P  p   (   (  P    @ H   % 0 A x` Xh  s ` (    (@ H  ζ   ` h   X )(  7  I W@ qH   } H  ` h   ɷ      X@ XH     ` 5h 8 R  p(   (  x@   Ǹ  ` h   h  (  7 0 N p@ `H  p  `   0  Ź(  ع   (@ H X    ` %h   > X  L X X e @ yH      x` h     Ⱥ( ( ܺ p  @    2 ` Fh 0 U h i(  p   (@ H     ` ûh   ջ  (     (@ H `   & ` Ah   X P   o(       8!@ H X!  ! ˼ !` ڼh "  @"  ( "  "  #@ /H 8# J Z h#` n u  }( #   $@ H (   ۽ @$` h $    1( $ E % a 8%@ qH %    %` ξh %  @&  ( &  &  '@ !H @' . ' 7 '` Lh ( ] `(  (( ( p  )@ H `)  )! ! *`! ѿh! h*! *! * " @+(" p+" " +" " ,@# H# ,# 1# 8,$ >$ h,`$ Kh$ ,$ T$ X % g(% ,% v% -% % `-@& H& -& & `' ' -`' h' -' '  . ( (( P.( ( x.( ( .@)  H) .) &) 8/* 0* p/`* Fh* `* Y* / + c(+ /+ t+ 0+ + X0@, H, 0, , 0- - 1`- h- @1- 1- 1 . 2(. 2. . 3. . 4@/ H/ @4/ 0 (0 4`0 @h0 40 X0 4 1 m(1 051 1 1 x5@2 5H2 52 @62 `62 3 3 6`3 h3 6p3 3 3 7 4 (4 74 44 74 I4 (8@5 X5 h6 6 8`6 6 x6 6 8 7 (7 97 7 :7 7 p:@8 H8 :8 8 `9  9 ;`9 h9 0;9 39 X : C(: Z: v: :: : P;@; H; x;; ; ;< < ;`< h< X< <  < = (= h<= = <= = <@> uH> (=> t> p=? ? =`? *h? 0>? 1? h> @ >(@ >@ W@ >@ e@ (?@A ~HA `?A A ?B B @`B hB P@B B x@ C (C @C C @C C 0A@D HD xAD /D AE >E HB`E NE _E xB F x(F F F BF F F B@G HG CG H H PC`H hH CH H C I $(I CI BI 8DI YI hD@J iJ sK `K K  L (L DL L DL L  E@M HM `EM N N E`N N - O ?(O EO MO  FO aO pF@P xHP FP P GQ Q @G`Q hQ GQ Q G R (R HR R XHR R HR H@S HS IS S HIT T $`T 4hT IT CT I U L(U  JU ZU HJU kU xJ@V vHV JV V `W W J`W hW  KW W X X (X PKX X KX X K@Y HY LY Y #Z =Z 8L`Z YhZ hLZ m [ x([ L[ [ [ [ L@\ H\ M\ \ 8M] ] hM`] h] M] Bv] N ^ (^ `N^ ^ N^  ^ N@_ H_ %_ ?_ 0O` U` xO`` fh` O` u` 0O a (a Oa a (Pa a PP@b Hb Pb b Pc c 0Q`c hc `Qc  c Q d (d Qd ,d Qd Ad (R@e PHe xRe ie Rf f pS`f hf Sf f HT g (g Tg g Ug g PU@h Hh Uh h Vi 5i HV`i Fhi pVi ^i V j p(j HWj ~j Wj j X@k Hk 0Xk l l XX`l hl Xl l X m (m Xm m  Ym  m HY@n Hn pYn .n Yo >o Y`o Lho Yo ^o 0Z p t(p hZp p Zp p Z@q Hq  [q q P[r r ``r hr r r x[ s (s [s  s [s 0\s P\@t %Ht \t 9t \u Iu ]`u `hu `]u gu ] v t(v ]v v 0^v v X@w x^Hw ^w w x x _`x hx @_x p_ y (y _y y _y y `@z -Hz H`z `z `{ B{ N`{ gh{ a{ pa{ a | (| a| | b| | 0b@} H} Xb} } b~ ~ b`~  h~ b~ ~  c  6( `c H c d c@ zH c  0d  d` h e ȁ He ( X  e  e@ 'H f 9 8f M f` _h X eȄ f g( 0g xg g | g@ H h  @h  h` h i ȇ @i ( i  i   8j@  H xj , j = j` Ph (k ^Ȋ Hk m( k   l  `l@ H l    l` h l  ȍ  m ( Pm 7 B m@ QH m ^ n l Xn` {h xn  ; Ȑ n (  o   o@ H o  (p  Xp` h p 9ȓ p R( (q a xq o q@ wH q    X` h 8r Ȗ `r ( r   s@ H Hs` Vh 9 3 Hs H s` Xh s hș 8t v( `t   p  t@   u ` h hu Ȝ u ( u ! 4  v@ CH Hv X v f v` |h w ȟ w ( w   w@ H xx  x   y`  h Py Ȣ y 2( y E z W  z@ hH Xz x z  z` h { ȥ @{ ( h{  X  {@ H {  X  {` h  | *Ȩ X| @( x| K | [ |@ |H } f `}  }` h ` ȫ } ( }  :  (~@ H X~  ~   ~` :h  MȮ h \(  g  r @ H X  (  h` h  ȱ Ȁ (   X  X@ H (  , J X` Uh ` nȴ  ( X    @ H 8  h  ` h   3(  B X ^ @ zH @    ` h  Ⱥ  (   P  @ "H  / C R` mh  0Ƚ X (  Ѕ   0 w v@ H    ` h    ` (    5 @@ CH  I ( U (` eh Ȉ v  (    X  @ H   X  ` h     t( Њ    h@ H   (  X` h  6  P(   \ p _ e@ rH   ،  X` h X  X ( X    X@ H     (` h h   ( Ў     P@ (H  ȏ  8 (` >h P E K(  Y  d @ zH (  `  ` h ȑ   ( 8  ` @ H      ` h X    | ȓ    }@ |H @P |  x  ` |h p | & P 3(  < ؕ  } D   }@ NH XP  } W  d ` wh {    0  @ H      p` h     <( D U ȗ a u@ H (  X  ` h    (     P@ 'H x :  I ؙ` Xh  j 0 u( p    @ H     ` h    ( 8   `  @ 'H p 4  C x` Nh  Y x d(  o x y @ H x    ` h    (     @ H     @` !h x 0  G(  T p Z @ eH  r y  ` h   H (     @ H   ( p` 1h  8  I(  R H a @ sH  y (  `` h   Ъ (   H  @ X ` Ίh     0 ( ` h `   ( ' : D G Ь@ UH  [ 8 d p` lh  v ȭ  (   X  @ H Ȯ    p` x  z z  (  ( ` 3 E ^ o@ H   ذ  ` h H   (    (@ H H  x  ` &h ` ,  ;( B V  ^ `@ gH  p  `        0@ H      ` h  " H  + 5  ? @ EH  N   A x ^ ` uh      ( `    @ H   (  ` h `    ( ȸ   $ `@ /H  : @ ^ ` dh  k @  w(  }   @ H P    ` h л    ( H    @ H   H  ` h  + ؽ ! 3(! E! (! H! [! @" оH" " x" 0# # `# h# X# #  $ ($ $ $ ($ $ P@% H% %  % & & !`& >h& G& ]&  ' e(' 0' l' y' ' h@( H( ( ( ) ) (`) h) `) )  * (* * * * * @+ H+ + 5+ @, ^, 8`, g, j, h - ~- ~- u- @. }H. . / `/ h/ /  0 (0 0 0 x0 0 @1 xtH1 P1 |1 1 2 2 `2 2 Ç 3 ·(3 83  3 3 h@4 4 5 `5 25 K 6 c6 u6 @7 H7 7 8 Lj`8 ۈ8 / 9 M(9 9 9 Z@: cH: : j; m`; wh; H; ~; p < < < @= H= = > > `> h> >   ? ? ? @@ @ @ A `A "A 4 B D(B `B SB `B jB @@C |C D `D %hD D D  E (E E E 0E E X@F HF F F G G `G hG G G H H (H H H HH (H @I 3HI I <I J EJ `J NhJ J WJ ( K `(K xK iK xK rK @L {HL L L M M  `M hM PM M  N (N N N N N @O HO xO O P P `P hP  P P ` Q (Q Q Q Q ,Q @R 9HR R FR S SS `S `hS xS kS  T v(T T T T T (@U HU U U V V `V hV V V x W (W (W W W W `@X  HX X X Y 1Y `Y ChY Y OY  Z Z 2Z X@[ y[ \ [`\ k\  ] (] ] {] ] ] @@^ H^ h^ _ _ `_ h_ _ s_  ` (` ` ` @a a a <a a vua Ea \b b   b 0b \@b Pb  `b #pb  b 1b  b <b  b Jb  b  b Jb b  c Tc Ɋ c `0c a@c gHc  Pc a`c mpc <c uc <c  9 c vuc c vuc i|c  c @Hc y|d |d Yd P}d b} d ]y8d p@d Hd VvPd @ `d 08hd pd yxd Pd .d yd 08d d d Pd .d /d yd yd yd ye ye y e y(e y0e y8e y@e yHe y`e \ he [ pe @[ xe Z e e e e e e  e !e 7e Ae Ke Ue  e  e ae ff gf of f  f (f 0f 8f @f Hf gPf fXf pf  xf  f  f  f =f =f f f !f  f 9 f 9 g g 9 g 9 0g xw@g 9 Pg 9 `g 9 pg 9 g Ag Ag 9 g 9 g 9 g 9 g 9 g 9 h 9 h 9 @h 9 Ph 9 `h 9 ph 9 h 9 h 9 h 9 h 9 i : 0i : @i 9 Pi 9 i  : i  : i : i 9 i #: i 9 i : i : j 7 j 7 j -: 0j -: @j 7: Pj 7: `j A: pj A: j L: j L: j j j Q: j Q: j Z: j Z: k 5 k 5 k F8 (k I8 8k L8 @k 9 Pk O8 Xk 7 hk pk 7 k 9 k 7 k ^k R8 k [8 k ^8 k h8 k R8 k hk k8 k 6 l  l v8 l W(l y8 0l |8 @l ~8 Hl 8 Xl 8 `l 8 pl 8 xl 8 l 8 l 8 l l 8 l 8 l 9 l 8 l 8 l l 8 m 8 m 7 m 8 m ^0m 8m 8 Hm 8 Pm 8 `m 8 hm 8 xm 8 m 8 m 8 m 7 m 8 m 7 m 8 m 7 m 8 m 7 m xm G9 n n P5 n 8 (n ;9 8n @n 9 Pn 8 Xn 8 hn qpn 8 n 8 n 8 n n 8 n  n vn 8 n 8 n 9 n 9 n o  9 o xo 8 (o 9 0o  9 @o  9 Ho 9 Xo Q`o 9 po xo  9 o bo 9 o 9 o ދo 9 o !9 o $9 o '9 o o p *9 p -9 p 09 p w0p 39 8p 69 Hp ~Pp w`p hp wxp  p :9 p 6 p Kp =9 p @9 p C9 p F9 p J9 p M9 p (p ^9 q pq `9 q c9 (q f9 8q p9 @q f9 Pq s9 Xq v9 hq pq 9 q 0q 9 q 9 q 9 q bq 7 q 9 q 9 r rr r r  r  (r 0r 8r @r `r   pr H r h r  r  r  r  r  r & r 9 s N s a s w 0s  @s  Ps  `s  ps  s  s  s   s  s * s ? s U s k t | t  t  0t  @t  Pt  `t  pt  t   t "t # t 2 t @ t N t b t t u  u  u  0u  @u  Pu  `u  pu  u iu iu 7 u 7 v 7 v 7 (v 7 8v 7 Pv 7 `v : pv 7 v 7 v : v 8 v 8 v ; v 8 v )8 w @; w 78 Hw iXw iw 7 w 7 w 7 w 7 w 7 w 7 w 7 x : x 7 (x 7 8x : Hx 8 `x 8 px ; x 8 x )8 x @; x 78 x F8 x I8 x L8 y 9 y O8 y 7 (y 0y 7 @y 9 Hy 7 Xy ^`y R8 py [8 xy ^8 y h8 y R8 y hy k8 y 6 y  y v8 y Wy y8 y |8 z ~8 z 8 z 8 z 8 0z 8 8z 8 Hz 8 Pz 8 `z hz 8 xz 8 z 9 z 8 z 8 z z 8 z 8 z 7 z 8 z ^z z 8 { 8 { 8 { 8 ({ 8 8{ 8 @{ 8 P{ 8 X{ 7 h{ 8 p{ 7 { 8 { 7 { 8 { 7 { x{ G9 { { P5 { 8 { ;9 { | 9 | 8 | 8 (| q0| 8 @| 8 H| 8 X| `| 8 p|  x| v| 8 | 8 | 9 | 9 | |  9 | x| 8 | 9 |  9 }  9 } 9 } Q } 9 0} 8}  9 H} bP} 9 `} 9 h} ދx} 9 } !9 } $9 } '9 } } } *9 } -9 } 09 } w} 39 } 69 ~ ~~ w ~ (~ w8~  @~ :9 P~ 6 X~ Kh~ =9 p~ @9 ~ C9 ~ F9 ~ J9 ~ M9 ~ (~ ^9 ~ p~ `9 ~ c9 ~ f9 ~ p9  f9  s9  v9 ( 0 9 @ 0H 9 X 9 ` 9 p bx 7  9  9  9  9   9 9  xw 9 0 9 @ 9 P 9 ` Ap A 9 9 9 9 9 Ѐ 9 9 9 9 0 9 @ 9 P 9 ` 9 p 9 9 9 :  : 9 0 9 `  : p  : : 9 #: 9 : Ђ : 7 7 -:  -: 7: 0 7: @ A: P A: ` L: p L:   Q: Q: Z: Ѓ Z: 5 5 h      ( 0 8 @ h H @ P  ` @ h p x         ( h Ȅ  Є ؄ 0   P   h      ( 0 8 @ h H   P  ` @ h p x  h H   @ ` 0 h ȅ h Ѕ      h      ( 0 8 @ H P X ` h `p h x   h @  p   `І  ؆   p (  h      (  ( ( 0  @  H P X h  p x    ( ؇ h   h  ؇  h     ؇ h ( @ 0 ؇ 8 h @ ` H ؇ P h X  `  h h p  x P h  P h  P ؇ PȈ Ј         0 0  8 P@ pH X 8 ` h p  P  p  h   Љ  ؉      0 ȏ   <|   >r >r@  H X =` p x        А >ؐ  !     0 '8 H 5P ?` Hh x T  ` j  ȑ Б  ؑ     & - 4Џ 7؏ | h | {( x@ H P X ` h p x          Ȍ Ќ ،          (  0 !8 "@ #H $P %X '` (h )p *x + , . / 0 1 2 3 5 6ȍ 7Ѝ 8؍ 9 : ; < = > ? @ A B( C0 D8 E@ FH GP HX I` Jh Kp Lx M N O P Q R S T U VȎ WЎ X؎ Y Z [ \ ] ^ _ ` a b( c0 d8 e@ fH gP iX j` kh lp mx n o p q rHH HtH5 | % | hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1%Eu D%=u D%5u D%-u D%%u D%u D%u D% u D%u D%t D%t D%t D%t D%t D%t D%t D%t D%t D%t D%t D%t D%t D%t D%t D%t D%}t D%ut D%mt D%et D%]t D%Ut D%Mt D%Et D%=t D%5t D%-t D%%t D%t D%t D% t D%t D%s D%s D%s D%s D%s D%s D%s D%s D%s D%s D%s D%s D%s D%s D%s D%s D%}s D%us D%ms D%es D%]s D%Us D%Ms D%Es D%=s D%5s D%-s D%%s D%s D%s D% s D%s D%r D%r D%r D%r D%r D%r D%r D%r D%r D%r D%r D%r D%r D%r D%r D%r D%}r D%ur D%mr D%er D%]r D%Ur D%Mr D%Er D%=r D%5r D%-r D%%r D%r D%r D% r D%r D%q D%q D%q D1H5dRIu81A<$jH ЏIMA$1^HPHR1IUA$6L ;RLE1LMAEI|$H|$@MI(HT$PHEH4$HDA|$ u|$LsyH|$pAAD$ A|$$+|$H[[H|$xAD$$A9D$ =-AD$$LLQE1MALgQLE1LEAEADHT$@H5E H E D\$ HEH4$|$ @|$ (DD$ EOH|$"IHD@DH @ H|$4fAD$ SH|$0AD$SH|$@ID$H|$BDET$ L%IPM E1AE1LE1H|$dAH|$hDd$$AHD$(EQD|$ A/v]HD$(I|$H|$A|$*uND\$ MT$LT$A/Ld$(ID$HD$(A $Ld$HARAD|$  HXLd$A*t$ IL|$/v1H|$(LGLD$(DEAEHEIL|$H|$0t$ ADd$$EALd$0D\$ IPHBOcH=TOHH̛H进L0HLLmHHEHD$HM@LHLLmHL]L\$HMLHLLmHLE LD$HMLHLLm HLM(LL$HMLL}HLIHM*HHl$HMuQI}HHQH|$ It$Q|$AD$fDIMD$E1QH|$ID${QDL$AD$fAEIM\$HHk AA"tDHA't.DHE1ADE1Hs1lLD$L%[_ADL$&DL$LD$AALd$(EtIHDHSExAtLDHAT$ExAtLDHAWHD$(HT$8dH+%(@HH[]A\A]A^A_ûLDL$LD$H5H~;HH5HLD$I|DL$Ht$nDL$LD$H5HL11LD$DL$oHL$t$Iljt$L1HL$PDT$L\$xL\$DT$DL$LD$LDL$LD$L%1ALLD$DL$~t$HL$Iz1HT$(LHLD$1H1Hu HLD$AxE}(u`HE LD$LD$t HEXH=GH|$(KHt$LGDL\$(D*H} LD$D$LD$DL$E(xALLALD$(HFAHD$(LD$L%eFDL$xDL$LD$MrH=0aH|$`QDDD$hlA7HD$pLD$XDL$TL`f EH|$pu |$,H|$pu$*H|$pu$t$OHt$pH$H$dH+%(>HĘD[A\Lc`LT$`DD\$hKHEH\$`fD$h/$Ht$`Hoc$Ht$p$Hx$HD$p|$,L_LT$pDD\$x$xH~_H\$pHދD$xLd$0|$xHL$89I4$AtH5B_T$xp|$PT$P҉T$PL$LL$LtD$T7|$,1ydLoDLD$`DDL$hDL$TEt$$L\$8H\$0DHDEH|$,t>H5z^Ht$`8|$hN$y-L%CLd$`j0t$hLL$L c A$H^HT$`)L$hFijxH|$`H CCHL$`D Dd$hL-:8H=c LH5yH1z{$HtHD)ƒA 1HAukA1LLD$0L\$(LD$PL\$(IA8LD$0L$I)IcNXL9~L$_E1)L9NH5BLL\$0LD$(LD$(L\$0uII9ILFY)H5xBLMLD$(L\$0u 0)H5SBLLD$(L\$0tH59BLwLD$(L\$0@BxfA$""I LLD$(.Lc HH@ML+c L9LD$(BLc Hc L9dH=c LH+5Xc HHH!H=HH+ >c H9LF1fInfl)-c H9;A4 7A HD$E1H|JLDApHtJL(ID9D$w߉D9L{@E"H5 ALLD$(L\$0u IH5@LLD$(L\$0u ʚ;"H5@LLD$(L\$0u @H5@L_LD$(L\$0uQJH H5w@L4LD$(L\$0uH(H5P@L LD$(L\$0uHƤ~yH5'@LLD$(L\$0uH2NH5@LLD$(L\$0uHd "H50gLLD$(L\$0HH=>EZ@AAAHk`|@Hs>H=}>~IHR>/H=\>]L]A@"$ML$ Ld$8MHl$(H\$0IH>H=>H=H==~H=H==~H=H==~AF@H=H==~Mk`II u(M(IMHc=H=m=n~HK=H=U=V~Ht-Mu@uTMID"H=6H=#=$~H=H= = ~H<H=<}H<H=<}L$E1 ^ HL$HA<A  ^ < L$H|$ u^L\$ (HH=7^ LL$@LT$8L\$0LD$(HT$ HT$ LD$(HH0H !^ L\$0LT$8LL$@H;H= < }AEDL$!H;H=;|MwL=kH<H=;|Hu@|$@HHt$(H|$LD$ Ht$H|$(HHD$LD$ HD$D\$@H6;DH=@;A|H;FH=(;)|HMk`MnIpIk`H$LIHH=HD$IL$`H$H|$HyHH|$HLD$Ht$HD$I9I9_I9VA$@GDM4Ht$E$HD$EAE9HMLAHqH|$HD$uOHI`5AIIA$@uLM9I9l~LJ}$ $P'D$<'H$H$HD$D$<*H=9H*T$'DŽ$P)H=JW H5û1H%Y H|$(H|$(!H|$P1H51HX %=X X L$L+$I` H$H=J92HH$~&E1IL$D$xD|$8H ;X $@,'H|$ LD$@M$H HL$XLiIH}I9tHH5^71H$H$#KLD$LL9:E1113AŃ L$H$LLHHfo$LL$L$PL$`LHH5)$PH@DŽ$hPH$H$h=V H=7HD$H]H{HLLHSIHEH]LLHD$0LfLnfM:"DS0HH$(H$LIHHp H@H@H@S(H|$0HELLHT$`HPHH$PHH|$A1Aă-ILLS8DH$PuLH$P^HHDŽ$DBLsU Ll$XL|$O<*HD$ Dt$ D9t$8F=U Ll$hDt$8D|$tH\$xH=.U H5ҰBHH[H$PL11H H|$bL$Ll$T LD$ |HT$ H56HI1MLH GH|LMLIA9 lLHp hIJ< H|$(p:#E13H=DT 1eA9H-T H|HtFHI}H58 D$0H=T H5HHrHH531H$g$1蠾Dd$hHD$`9$ /HIH HLkM\IA; 6LHp =IJ<(1H531tL$L+$HS IL$H=R I9H$=R L$L+$IL$Hj3IH$H$HH)H$HH$L%R E1L!H$ HtR H55211pH]R H55211upH5^11epH|$(6!H|$("k H|$( H|$(L$L+$IH$H:HH$H$HH)H$HL$H=YI8H$)LE10M)L$B(HDŽ$LL$H|$u$rH$H521H1-oHuDk1H51L1HD$HP H5111nH|$(H|$(H=}P H=qP dH=UP HZP MH:P H|$@8H|$(1H$dH+%(uH[]A\A]A^A_LL$PL$MHiDH|$CSLS(H|$0L$PLt$L$KL.YH=O H5-011踺HH|$(qH|$(]H|$(IE1lH|$(-H=/HN H|$(H|$(BH|$(#H|$(H}HH|$(I}H5tDT$`AEDDT$`@H|$(L11L$PH L11LH LH$H&L$`H$hI9XH$Ld$(L|$H->-H$pHHH!IL+$XIL+$XM9HF1fHnfl)$`L$L$9$XM)I LHL$IL$MtL;$ L$LMPL$A'L$L+$IL9 H$LLoH$LH$H;$` H$HHHH$'H511j$H5LuD$pD$<"1 LzƒOt$<>L H J H=,H|$(HLd$UHUH=K r=K HK 1|$<HD$HH+D$PLd$0E1HDt$8HD|$HEHt$H$P~1D9l$uH5è11RdLd$+AE1A}*DE H=0F AJ4DE о5E H=E HF H賾5E H=E HE H薾H wE fn$H_E IËfE H5E f:"f$L,M${MeR2E H5c11r56H$11\5 L|$M9McL$AH$L$I9twH$ H$LIHHH+$I!LH+$H9IF1fHn1fl)$IY H|$(L$d$@||$<Ll$0Dt$8D|$HuN191D H5D A܃JH=C H$C 'LH|$1H Hy|$tjH="1H<HHtyL$LdLH+$I<$HQL$M$MH$H=$$\HH=$HHiH$H+$HL$LE!ML$H$L+$IH$H #HH$L$HI)H$IL$HA IH$|$u\|$pHcL$ MIHH+$XM!LH+$XH9IFfHnfl)$`xHD$PHc観LD$PH > H.HD$PH1AIcEzLL$LT$PLHj|$<MMYIQMiMa IA(== H;LH6LcL%B= Lt$ O,H|$(e1H5H1}IH n= zH|$L,=H|$ a$H LH5?H1A DHHtcH5&H1AH$1DHH|$P3Ht$P=< LEH|$(H ==W< MMLLH5H1cH511NZ < {LuXHkXLHeDD$@LIkXH4$dHEH=ef[t$@D$@HcT$@Afo\$ fod$0D$DH<HkXH<$L\$HH$)$)$ZD|$DLT$HL$H$LIkXH<$McH4J< AAWEAD1H5b1H\H= Hu HD7$8H|$DE<H|$T$ƶT$ H|$讶|'sHcH5\11X=t: H4$H=1E1`zH=]: H@1L1xH;H9 H5"11IXHHL[]A\A]A^A_H$H5A11XH11XHD H51H1WL\DD$ 荿DD$  HX9 H5ٝ11WHA9 H511WLH=b"LCHHLLt9HtH}L;WL wfCnfA~v E96DAщH@HkXLXIkXLl0M\LLL`H`LXA H`Ht HyHH!ЃIAHHtWHHIYLLLljL`W`LELtLH=iWIyLH5N11L"(8 IIMG11HKH5\UHL ^MAfo{fA~|ffA~nDtLE1A9LXIkXI|%twLD9LLfo h{f8=fA~XDtH]1A9WLVMkXJ| ILA9LkXIwK|IWH5911THA^H=HMV1fozf8=fA~LLoA94fo%zf8=fA~H5Iq .Mt;IVHH>H>MHHPHLH QLLljL``LELJtLgAH511MkXKT(%5 MWHXH I>?EH?MHEL 9QHXLL9'EH@11MkXH5JT30%)5 A9foyf8=fA~H8C1A9}HkXHTHI9WHIWH5U11RH|$荰H|$=4 i1H57HSdL<$H$HHHLHL#H話L1Ҿ 71LHHL$H|$H#HmEhH$H=H{HL / HCL,% H{HLIHH>]H=襔ĒATLFL9vLH5(H=1nILA\ÐIHNHGHLH9sPH5H=k1nH)I4L9IGHHWwHQ HH H9? H6 LH+D$) PH=:ٓo@AD$ H=輓I7J<#HT$HL!L9]"IPHuHPID"H8IPD`A+&HAEAD߉M^hHD$A<)$$DŽ$t};=0 $A&@@tAuH=0 aO$A H=/ aH=/ H5}1^4H=/ }M(V0 uL / 0 L $Y&AD5/ D5/ D5/ A9&H=\/ H5|13t]0 =n/ ~O=/ tQL/ H =/ H $M%H$H$H=/ A%H<$A%=/ H$H|$pv腷L$xHT$p1H=. H5t|G3ʹA&L-. H5tM}IELPHc$A}CH H42LH(A}D1H5~tL\H=C. LA}DA}CH H5 tLHDѱ]LO%$H<$AL-- H5 tIL蘱Hc$L  I4A}C1LHpM%LLYHLQL̑L`%H=K{1<LIHLִL茑H-. H!D$H<$D$!H$Hl$u%A>k%D$@HxL\$PHl$0L\$8HT$D$@;Bx1%Hc\$@Hك L|$MItL.H|$8Au/l$\AuH|$pL|$PDd$Xl$ |$||$(L;|$pAD$@z h- H$H=4, =RH=(, #Ia$ 8- H$1H=, RH=+ H4$AW$, A"HqH=qLLkMNhA)a!LD$0ItD;d$x2*"MInLHEMNMI9LAVMVMIZHA>ImL{MmDLLl$FH{H?DSLKMMiM~H|$HcLc| 0t$ LDt$(LDAčP؃D9Mc]D9D9A)E<+I}E)E;}LcJ J4H99LcLcM)D)K LL$(HLLT$ HT$(Ht$H|$ I} E}LLfDnfD:"ImfDT$HD}]AA9uE}H1ҾKHAAJ4AIEImD DxDmHT$EMDMJTHoJH=owJ08cfInLHL@L8HFfH:"H@HLXH@HP @()L$GCIFHt6LH8AVMFAMt]uYIv IxHtMFIX}(bfod$ INHt]~AfH:"@HAIF@(cbfo\$INHt EyfHnfH:"QPHAfh뱿(bH;fDD IH@H@pKHt&AUI}A;U}wI}IcUHLsJI}DLcCHKH9DSLCADžMHs IxHtLCMhD\HD$HIcD\$DӡT$DIEHD$HAU\L5D(L8_(aD LcLhMtaA~|$fI:"xID$HC(`D LcLhMt#EyfMnfM:"D$D@ID$fEDHHlH=lGw`H|$LH*kIm HHD}DeAE9uE}H1ҾHHAAJ4A芠IE Im D DxDmAUUJ\H>lH=lG1Ҿ1GljH41'IE H0Im At$11Dd$IE mG1AljH4AL$E1IE D8II9NLNLIGL?T$DIcD$(DL$ 螟DT$ Mc]IEHNjT$DEUD$(HUkH=0kF1Ҿ1F1ʼnƁH4>IEHIm7D@Im IEs11{F1AljH4AE1IED8I9tNTNTIXImHjH=j`ELD$Ix/v@LOIqHwMWIH51IӫIWLH蠧#AɃLOHD$LXEA/v@MKIyI{IOIH55j1HsIwLH@#EAMKE뼃$p HiH=ioDLL$Ay\FHI豪LSxL+SpHL9w\H{pHLIHkp'AD菁HIqL[xL+[pHL9w+H{pHLIέHkpH|$ HHH|$ H9E["L\$I{/LGIpHwMOAH5l1IIWLH9"LL$IQDRAVHBLXLZMGH5hI躩IHL臥!HD$LPEA/xMBIxIzIOIH5+h1HdIwLH1!Ht$LNA/v@IALPMQM_HH5g1IIOLH4!ЃIAAHL$HqDA/HVLZL^2HbDB@u |$_0L褷 LL$IQDA/RLZIKHJIIH51g1HaMGLI. DAHVDkLL$MQA2/QIRLZMZL MCMBAE1҉l$(MH\$0LLӉD$9\$It$T1HH5fƧI|$HL蒣L$98HHT$LZE A/MCI@ICMA:ACH5ciLT$#LH-(L@Ht$>IOWH5q1HIWLHL)ACLpLH5dID赢 MZ~A:M /v MZIA2EAMCE HeH=e?HSe.H=l?l$(H\$0MEMH=`BOA*LSpL9SxHspI|$H_L^L[p*EeBb|$<D$Ll$@D$HLlp?s:HKpH9KxDLSpLoIrHspAsH|$ VH{pH|$ >HSpEeIL *_HBHCpD"AmAiL[pL9[xuHcH=c>H|$ ܚHt$` H|$`h;D$|$0?$LL$@AHNLpHPcH=Nc >@sH.cH=,c=HcH=c=H|$H|$ &H|$HbH=b=HbH=b=HbH=bi=EAMBEH|$LGA0/v@MHIQIPIGIH5bH1ȣMWLI蕟AMHA0AȃLG\DAHBDR@t$nHt$nLD$o=mHaH=a<EALZDLD$MHA /IQHzIyH2L~,ET LL$IQ /LRIzHzM_AH5wa1I蔢IwLHaʃIQA hL,^ LQHD$L@EA/IPHJIHMWHH5`1IIHL۝/LT$MZA3/v@ICL@MCMOHH5`1I轡IOLH芝ICA3DAIPEZHT$HzDA/v@L_IsHwIGIH54`H1JMGLIkEAL_DAʃLR aHD$LHA/vXMQIJIIM_IH51IؠIHL襜HD_ H=B_9A҃MQALT$IzDA/LGIpHwIGIH5H1[MOLI(|HT$LRA /vSMZI{IzMGIH5^1I IwLHכ+EALGDhA˃MZA H|$ 聕H@^H=>^8LCxL+CpL%]ITH|$ 7@LSpL9SxtL[pIICHCpA%H|$ H|$ HHD$(LD$(HsxH+spL%#]HH|$ 赔Ht]H=r]-8H|$ 艔@YLT$IRDA/HBL@LBMOHH511IzIHLGEJHXIzBHA*AzsLd$MT$DeJ|pLA /MJMAMBEH9IzHwIrLEIcLLT$PL\$ILLH;\VH=9\6 Ht$`蠠HT$`AÀ:sHD$LPA /rσIzA mH[H=[6H[H=[~6΃IrA DH9tH[H=[R6DAHBDTHn[H=l['6LLT$uL\$H|$ lLS[eH$[H="[5H [H= [5HZH=Z5H|$  Eu/AH|$ ّHSxHZH=ZM5LHt$` Ld$`A<$$u.|$0Md$u:l$D$<D$l$H3H-ZH=+Z4HZH=Z4HYH=Y4H|$ HYH=Y4HYH=Yr4H|$ HАH- H|$ L跐H- UHSH HHt$聚Ht$HH;HtCH9tHH3H[]HHt$wHt$uHCAWAVAUATUHSHHHH?dH%(HD$8HF HD$AD`t /HBAAw%Hcu@H+YH=7Yf3H=jRHL$DXHL$HtH;tyHtE19owyAD$ AH,$HH\$H= RE1st$ t$ 8HD$IƁowxAAN)I^AAENEtltcADL$ AANAPE! HwDL$ ~(DFDEt?EHWLWIIEt#AHWDɾ H= 1! EuEuD$ AH" HH VH=T 0HUH=T/foL$@fot$P)L$ fo)t$0H\$0魏AWIH5dUAVL5vTAUATAUSHHHL$ xCAEHL-  LDHMtMH5vULԗtwtF T$ EL;~'DDEt?EHTH5THIEt#AHTD H=b 1R HMLH[H = ]1A\H=TA]A^A_AUATUHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1IHT$ HLH$HT$$D$0HD$Hc LHHIiHD$dH+%(tDHL]A\A]HSH=S-HI|$XH[]A\A]A^ÈXHL]A\9/4/; HL9u LAE9|Il$鬒LL轉I}HLMeEȐE1A9} HAƢ鼒LLT$ pT$ $HSKH=Y,H$X"HDS"H=Y,INL#H0SH=Y,CH{H|$hPA9LcHk(HLcN MLN M9r AA9Hk(DT (D뾾 LǡPHRH=X+L$pL|$ H P"(CYj[x$lL$c L ;L$ L1$lDnD9D LAL$EL39j$DZ,fEnfE:"fDD$D;$lHr0DT$(PDT$(HHD$H$H$ZH$LL$DT$hD H$LL$DT$(L$(H|$Ɖ2HDT$hHHD$( C9ub{D$1ҾH߉L$x*HAIk(DD$hHst$hDL$xH$pD$DH0HT$LD$%H$pL\$(CHk(DHH$PDKH$H|3LL$L$DŽ$Ƅ$.BDT$(D|$D|$l$x L8H$ $lL|$h$l$9kt$A9w  A$tQAW;$LL8A7L08H$|莞Ls5$I(낾 L 8L$ LK$lDiD9|!Du L AL#L7D$L$9L$(DL$x1D|$HLt$HMME9]Lk(B|3HAW;$|GLL7$KtEIwH$[L`4M_D$HNH=T'A7L6HN&H=oTw'H$PH$p1Ҿ1DT$xH$pH\$h'H|$hHk(HӁHpADT$xH$pL DdLr0蟜zLA \"L ?6L$ LjD$lE`D9|4DLAAr0CF,SLr0*#L!DMMLt$1ҍp1D$xHDŽ$p&1AIk(D\$hHrL$xDT$h1H$pALk(IDD$L9H|Ht H(J|A^nHLH=L%HLH=R% L$HL|H=TR\%H$ L$AA E)E9EOG D9C<'D)9 ))$lDŽ$lA$JtEH$1HU;$hB.H߃LHKH=Q$H+K{H=gQo$H\$8|$8$u 1A9V \$8ELD9rA;T wxDo$Do$D)$pD)$$$$$Hl$PHH bHCJ1H=P#1` L$PE1MtjE;ZsdEMk8ME}E9E;| MMH$L$D$H$pL$xL$D$41H$XHtV;osQHLL1胊$A;trSA;t wLfDo$fDo$D)$pD)$HIH=O"A tHI+H=O"$;L\$ LL$ -LL$L\$ $G H|$`tELt$`A~H|$ DH|$H|$(&fDoFfE8=fD~$hs Hl$ DHl$Hl$(HHXH=N!FDF\ E9w:BtB;twFA9sYAID9 HHMH=N!HHHH=wN!HGIH=_Ng!HGKH=GNO!HGBH=/N7!AOdIOHJ\1H HpGH=M!H|$`Itp,H$` DKH|$ fּ$$Aq4t$XH|$x@#~$HII$t9HC A$p)A<$}HcHqH9s0A9HcIcDLIH$HH$L$&!HuHmLHH$$H$ L$L[ L;[09LS$D$Cs H{k(KDK K,'C()CH$XHFH=]LeHFH=ELMHl$}x\Hl$1ҾD$HHAÉH4D$Tx$$HD$p8r$111AD$J4xT$$E1ہIȉI9'J|J|IHEH=kKsHEH=SK[HEH=;KCH{H46L$L$H$D$$$H$KwL$L$HCL$LC0H$D$$D$vH EGH=EHEHH=EH EkH=lJtD@HD$pLT$ABo GD@<Hy[]A\>xLCrHxyH= H5J1>H輁uE%D$HHt Ht$'t'ڀHJH=hBD$H=1 1H5I|$~H= H5I1H= H^H5C1HHtH= R YHD$dH+%(uGH([]A\A]I<$Ht 2I|$Ht 82ILL$$] HHWIH9s(SHH)@H<HHtH)HH[LGwMgMIwI<$HtMG I|$MtAID$ ME1M]Mt.MOI;MtAM]MW I{MtAM]Mc MIEHt-MwH8MtAIEI_ HxHtIEL` IMu (L1MtMuMf(Lc1HDž(vATSHH=fHR{DL% uH=HH;LH1H;X[A\*Ex9M9rBA$LL1ĀLLL|IT$LAI41ҨtHLLL|LAHzHwH9rA)AAE!AC4<dA?IA L9wAGAw H4Aw H!Aw HAw HAAHH)ITC~4tt-PH@~H=>AHDD ÁHkHWh1HWHEJ1Ho@fAtfAtHn@fufG fuDZA\A]114f]011HX@ H=\@HHZ@H=<@1gH;@H=@LK8H{@IfInLK8fI:"I9ރHt H;k Ht]LsLk0 Hk(MHLH+S0{IHtCHH{Hh}tl1҃Ls(Ls0I $鼃Hk(LsCHH{M<.}u1MHg?CH=;?HMH9K0rHՂ1HAv11r1HkIAHoDE1I$LkD(M9tBoLBLNTNTIDpI,$HM=H=_=DAL%FH-FGFlDAA!E9t IIuHLAHAL9r!LLD"HD@uA?DH9u݃vwIwwIwwIww Iv(d\L)HQHA AALIADAEdIcA;AڽA<CH=?H=A<H=?~H Hs@HEsH9Z[]HnLE( AH=2G@%HkH:?H=?H:rH=>A9 H:nH=>1 Hh:ZH=>1W[]A\ÐxwH!G}! L !UHSHHHT$`HL$hLD$pLL$xt@)$)$)$)$)$)$)$)$dH%(HD$H1HT$PH$ D$0HT$@D$40HD$8'yHl$Hk$HߋHC$Ht$0Ht$Ht$L$HHk$HD$HdH+%(txH[]HHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HT$ 1AIdH%(HD$1H 8HT$H$ $D$0HD$ HD$dH+%(txHÀ}x7HbDmAH4HAhHD DhJ DmH1D1AAJ4AhEE1HD M9tN\N\IDhL$L|$p:H$HT$p(H$Ht$pH$HD$pH$Ht$pL$Ll$pvDAu9HHLD'xHtP~ IH)uɇvDAtL=7L$Ld$@L$E$L|$poHH=6E1H$L$LT$p@hH$1AG1Ld$PH$H|$hƄ$H$DŽ$ELFEL$Ƅ$D$ET$ D$SAt$ H$SH$S H$4S(At$H$S H$4SH$ SH$(SL[H$1AӃH$S4RLt$P\$|H\$`M&I|HAT$LD$PH{D$xIIxPHT$PD$$z Ht$PHNH|HSHD$(L\$PM#A{ I{ID$H|/(ЉD$0LD$PIAx IpHZH|.,ӉD$4HL$PL y LQMqI|*0AHD$L\$PM#A{ I{ID$H|/8HD$8D$|鯄H$HL$pLRL2I| AVHD$(.HQH$sD4H$AӅuuH|/ЉD$0H|.ӉD$4I|* AHD$0H|/$HD$8GH5Iucs81A<$Qsu[HHHDtHt~1HH)HHt31IUA$順rtH T3IMA$1~Ld$ 1L$LLD$HT$LLT$S H|$$DS H|$(HS(H$H|$,S(H4$H|$0S(Ht$H|$4S($H|$8S $H|$E…ttLSIzIZH{R@t-t)LCMHIXLKLEIXIhH]M$LSMZIZL[LUMjIjLmM$[]A\A]A^AVAAUATIUSH?/I,$DuAT$AŅH]HH]H3DAT$uEy)HKHkHMI$y H{u H{uLsHkLuI$DAyLCIpIXHs>E…ttLSIzIZH{R@t-t)LCMHIXLKLEIXIhH]M$ LSMZIZL[LUMjIjLmM$[]A\A]A^ATU1SHHnjH{ Ht8;os&LdMtI<$KjL̀y(GH{Hty G[]A\ jj[]A\HtUHnH(]p:AU18k'ANi]jAWAVAUATUSHHdH%(HD$8HL 1/IIHAMąu%Ht)HH5(HwkuA/MWLHt$HD$D$(D$7H|$u i1 HHLEL= I7HHt$hHt$LHH$gu%H$A (tuHtHh`IH=v L9uHuH+H= 1EILLH5*kHtHWh11L%*HIDHT$8dH+%(t+M)Dl$hH|$HL\$PML\$XLT$`H\$pHl$xDŽ$EtIAv,H|$HM$IFPL9r1H5&H11IT$@I)L|$`HHT$XEMLd$HLF<H ,LcI>ALL\$0IDASAV0ILUIvH>A\ZuLLT$8IDARAV0ILUIvH AZA[gLH|$@IDAV0IvHWIULAXAY3H $H$HL$@HT$8L`LL$@LDIvHAV0AQIUI^_L-H$HT$@H LLHD$(H$HT$0H HT$(kAv0LHD$0Av0LAv0LHD$(H $HT$(H$H&Av0LLHD$(HT$(H$H IPIt$(Ht$(H|$Ld$ AZYLH5(1 1$H$dH+%(t=IHĘ[]A\A]A^A_SIMuLHW0HLZHZE1M9K HHkHHxH9wHxH9w`LAIH0H?Ht;L_H_E1M9vKHHkHHHH9wHHH9wLBIE111L[AHHL@LH[AHIAV1IAUIATUHSHIy, Ht u A%HLAAAĉǺ1I[D]A\A]A^UHSHQCAEyGH5H1Z[]IHϋ Aw2ILE1H)H~ 0HAIH L H2DHII1E1H9s.EHD߃HcI Ex HMÃ?u1I9w&HH9s9AAA4HAHMIMHLA A3ʉ A9sAAE1A)AD)fA )A)AfADAWIAVMAUMATE1USHLL$HMLHAHt$LH<$[D9H<$Ht$XuˉH[])A\A]A^A_ÃAWMAVHIAUH%IATALUHHh SDLL$@LD$8LD$8LL$@ALLHHH j LLD$8LL$@t#AAHHH=l ZAöHHEHDHT ,A46HHEHDHTAQLMLMDuZ[]A\A]A^A_AWIIϹAVAUATU1SHdH%(H$1L$HHD$L1A)v1;fTu flTxflTXDTTXH\$fB,SE)fBl\XE$)HfBdH9u1L1AH\$xAtPHJEAA9uE܉tS AMcE1L9vbLAAA IwfCAIAIAIAIAIAIAIfAIACfDILT$HM M)ډT$1I9v#MILHHH;0rvIKM1H5:PLA1ZHH9r'wHVH9WrwHNHH1H?2ÃUHSPH_HwH<0HHpZHE[]AWAHAVEAUL-ATUSHLd$PHl$XD$H\$`W,w P+IcLL>=`w=S= \=!|DHC H<$ H<$mDLckAƸLsOHC6 -HHCAA  H<$DظL[ HCDH<$dI9D$hH<$w1H5 1ID$ HCjDH<$I9$H<$w1H5 M1;ID$8HC"HC <$DHCDиLSDȸLKǸH{HCu;HC\H|$#H|$H!u1H5 D121 DHCH<$HH<$H[]A\A]A^A_kHC UHCH5LcI>Ac$^qHCX*t/wt!)A&+uMzHC YHC kHCHs }HC dHCD>HCHu g ZDH<$HtH9H<$w1H5 91*HEXHCH5 11H[]A\A]A^A_AWAVAUMATUHSHdH%(H$HFH9wHHHvH)H9r1H5HLE1IHH=H H)MG8H|$HH|$HAHL$XLD$PHD$`T$hHl$pLl$xDŽ$H|$HHuH|$1H5E1+H{pLHIHgMO8H$HD$8MHD$(IHLL$L$M9\$+H $HIMD$HL$IpAxK,APDK0DC(UAwt$(HT$(&H HT$IT$2Gw tntH t@H|$(LL$(s,HK@IAAQMAVH|$ ^_uhoH|$0HK@s,MHD$0AIWAVH|$ ZYt HT$0Ht'1I1MMHHLJHtHD$(H$E1Ld$(H$dH+%(tl*HĘL[]A\A]A^A_ËIMÃ1tGu^z tXP9uHQuHQ& u1HQMRIr0Iz({HHtH+PMLLAY1Z1AWIAVEAUATIUSHH$H$(H|$H$H$0Ht$ LL$(H$ HD$L$HT$0HspHL$8dH%(H$1Ht$HH|$@INL.HH:HL$H|$HL HHu1H|$8t D@LL$8EH$1WE1ҹD$D$Ll$PMD$pD$`L9mLLHHHEHL$XHpK,xAPDK0DC(t$Ht$8AT:H H}LT$XB<UtJw(tZwv.strHt$@H$}D$At A L$LK8}$D$L$pu}uo$D$T$`X}uR$ uHH$Hs@:}u4$ u*L$L[H}u$ u H$HSPIm|$Ll$Pu |$ta2L[Xs,HK@LASMDt$L$^_uHS`HK@s,MRLDt$LD$pZYut.uPLAt$0DLt$AUSAPIL$AQL$HT$PH|$HH0N}t }  $uR$t$tLl$(L|$8MtHT$LHLl$MM/LpH Ht HXL)1It$E1HHt$LLL$0_AXAŅyot$LAHt$H HLL$0Y^AŅy>t$ILt$H5rHALL$0DIXZEAMtH|$tHT$LH4H$dH+%(t HD[]A\A]A^A_AWAVAUATUSHH$ H|$0LL$HD$dH%(H$1Hw D$D IIH5>I̺LMD$DuA~uAFD$CuI~肼A;FufC|>YZuC|>uT$CC8T>uIwCD>CL>I<6Cl>H$  IoHHC|>GL>GT>G\>AD AD D 9HS H9HH)Ht$8L>H4$HD$8HL$8HH$EDEu%LL$HD$D$DIH AH|$8H$H$LHH$L^H$LFL$H<$MQILL$H)LT$HL\$CTCtCCL  9IL$L9H$H|$0LLHt$(HD$HH|$(Hl$LLLD$LL$lnLEI9H|$0tHD$ H Ef HDŽ$ N,I] I9 An @< HDŽ$A@@t7H$H$LLHDŽ$K L$HDŽ$@y3H$H$LLL$_ L$@M MZL9@ C<!5 C|) C|( IRI9 IZHLcM9 IuI~ AtEADELA D D 9 H$$1D$hD$TD$PHD$HH|$M9DŽ$I\$DŽ$G,&EAtAvHt$HEx\A3 ML$M9% AGl&HJL(M$ M9 L1L9\$(H|$HK4Il$I9ACL&EGT&AGD&AKTHcHcHNDAv\A.Il$}D$h,v D$h-D$T v D$T DDL$TDd$PDL$PAv 3Av-WE1$LT$ fCjII67u$L]M9AT.A\.K AAD.HL$XH<>AL$hAl.D+d$PH|$xAL$T¸AL$$DD$lHD$HD$pHt$LL$XL;$aLl$L9l$xQ,$\$LL+\$H#\$lL$L$LL$M+LHHT$ D$LL$LLLAMHHT$ 4$LL$MLLLHHT$ $LL$MLLLHHT$ $tO$LL$MLLLHHT$ [D$t$D$A$Dfnf:"$f֌$+MLLLL$HLHT$ X<$v $ $$ALLH$L$$M1H$t$L$AUHT$0TAYAZŃwPMLM°HHT$ VLt$ _AXw $AăA v$LD$E1AAE1ALDAE1DA؉$A)$DAH|$`LL$HT$`H$HLHT$ H$L$DAH$XE9wD$ADIED$ E9sMH$LLAH$$$)$!ƍ\X։$LE1AE1LT$ ALHt$`MH$L$K DLL$DAHt$`XAAuEIED$D<$$t$AعLLL$AUHT$0L$A[[D$HL$H+L$HAZH9L\$I H9T$(EuLd$H|$HT$CDLn9r(Hl$H\$H|$H|$HT$L)Ht+BLL$LD$t0$LOG9GH)LIt1A)LMLD$1H|$tLT$L\$CTL$PLD$L+D$HL#D$pI$H|$ HcIIi<$L7lw1PLLt$ LL$L$[ZYD$1AYH9\$rHl$Ld$L)Al,LMAMAELL$LE!H$C*L$Ht$`HLzHt$`tEAE!vMIL\$L9\$(.HT$HD$<$Bv<$ w ,$,$$LD$LLL\$H$H$L$L=LHHI9|$Cte|$Cta|$CHkI9H|$蕯ETE\E$EtHAAE AE E D9t AHI9r8L$HSH$III9uHHH$H9\$8tHT$(Ht$H|$09D$D/<$w $ $ $ NH$dH+%(tD$DH[]A\A]A^A_AWAVAUIHATUHSHHH$Ht$(LD$PLL$8HD$@dH%(HD$x1'Ht$HtOHM0HU(LE1H4UIHE1HHCڿCDIL9t$wE1H辿HD$Hu$HT$8Hl$@AHHE"Ht$HM0LE1HU(HHt$0HHL$(H$IHD$ H8Ll$HL$HHD$`Ll$PE11H9\$AN,A|VH1LD$pAPLL$8LD$hEF(AqEMt$`H A H|$Xtt;rHt$(LT$`IN@IAv,ARu0H|$XLM(贿ZYu>|$hu2L\$pM;](r1H5HH$Ll$褻IE0NI)I~ IM97L$XMHASAUHT$0Ht$$I^_H$1M1HL$OL|$0L$0IMLM$.Mt Ht$HH,tfHt$HH,HLFRAUHT$0Ht$$LL$HZYLL$8IL,Mt L,8L,H HH hRIULD$hH\$PH-V,I(vD$`E1E1D$8D$0D$HD$$ptH$XLLDL$DL$E/EL|$0m|$8|$`|$EH$1L$OB<#HH H uH|$1ۃ$$LLtAMAAME1D$MAE1E1AA$PH$8LLDL$DDL$$0H$LLD$EH$LLE1$H$LLǕm$jH$LL衕R$OH$xLL{7$4H$LLU$pH$XLL/}LLHH|$0 HLLME1&$xhA$LLu4HD$D$gE1䃼$LML|$0# DŽ$D$Et`D$L$XHL$HD$1Hyt D$LH)H9E1HxHyt MI)LL@H H H9L$(uAH$O1Dd$01H$0Hl$IHl$ HT$8LT$8K<"J$HHuLLLHH% N$H v}A;ZLIButE11CL HIH IuLLHLL\$XHD$HHH H|$XLD$HHuHHD$HH LD$XHt$HLD$XuE11LT$ HT$8J$8A:N"BDŽ$@t*B$H$tLLLǒHl$ EI HD$ I D\$0Hl$L$D\$ LMLL$M}HuLLLHH H|$HEv_8uZHpLLLHD$0tHH LD$0Ht$HHD$IxM@HвtHL$0H|$Hq11|$ H}HuE L$HD$H I H9l$(Dd$ HtHL衔|$u)At#D$pEtH$XLLE1bE1L$J8N0JXOIIHuH$(1$@1H$XH$|$0H$DT$0H5JHL$pHL$HH$HDŽ$HH$@HDŽ$H$H$H$ H$(D$0L$@DŽ$HHD$8HD$HDd$L$8L|$MMD$HH$(DL$|$L$ H$HL$胟D$XALT$(I9uH莟D$XHD$(L$H$PHLHt$(LH$hBH蝞DfAnf:"\$XDL$ Af֜$Av$H߃H5MDd$L|$p|$ ~H$ƒD$xD$xH|$LLL$@IHUH|$LLHH4HD$H|$ I$~H$P螝DDD$Wt$XHkpH$PcpH$_L$HCpHCxL$hL9r!MDd$L|$1H5LA|$0H I)1L$L$IH$H$$LL$L$L$L$DŽ$L貞HtL$LH蔞L莜L脞LHtw!uLc맃$HIH|$LLILHCxIH1LLHkpH$HD$`$_LH$HhLE1ϝLH$L؉$H$HH蘝HHtHI腝!uHMuLiLaLH|$LLHHL$IL)LHIHt2Ifnf:"I1fCl%A!uLlKD%HML$L$L$$$L\$`MZxHD$` M ACAK IkMcML|$H$Dd$LH$H ۖ HspH{x |$ H$P?|$t$xw H$Pޚ|$XHl$8WH$XL$`H~$hHChL$D\$HkHHl$(L#L+$LD LS(H$PfI:"LD$8LC D[0HC8HǃHǃHǃHǃs{XPL$AQH$PSAUAWL$DD$`Ht$pH|$8gH0$MDd$L|$ELLLH$IHtaH@fvH($@L$PHD$HL$L$H$MDd$L|$H|$HtcH$@1HLLHqpѽHtLH\H9\$HuH$HLH$PH$@HDŽ$HH$OH$LH$HDŽ$H$迿H$L調H$H$H ֓H$H$Ht$HT$H޺H,LLLHHLl$pLt$@HhHx8Ld$LT$HX H$XD\$0H$LhH$LpL`(LP0DHD$t L$IAMo u Mw MMM6IMIHtIHT$:A|$tLLL艇LT$ADd$0Dd$ D$JH$XdH+%(tOHh[]A\A]A^A_AWAVAUATUHSHdH%(H$1Ht$4D$4~H$E~ ȉE1|$4uH $H]},Lm H\$uH4$E111L7H]Lu{u {8u HK(S8tH5LA1{tHKHE1AwwH=LcI>AL%9L#MtZ/L$@HHcL1L%HL$HLLLHL$蒟…y>|$HAAmH3Ht LAw1H55LAfL ڏE11LLL$@HE1jjjjjL\$dASLT$hL\$XARL|$xLT$XAWAUAVD$lHPT$Ht$(HD$ u!Cu C81C8Ht$pHt$HH\$HLt$P$H=Ll$XL|$`HD$hLd$x{tl|$8LC(H HK({LSMtzL=ݎM9tn{uoLS1{8uHT$H4$MLHSE(Q|$8t L8L[(4H{(u-L LK( 1L%M sLT$@LSLSkH$dH+%(tH[]A\A]A^A_ATUHSHH dH%(HD$HGz8Ht8uC8Lc08tHRHs趝C8LeHSHL$ HsLDžxZjLME1LjjjjHT$0RH;s HL$HQ1ssHPt|$tHs(H{LD$LHD$dH+%(tH 1[]A\UHHfHnSMLfH:"HH\$0HsHt4LkLO\IsH9t LNI9uI9kuH9s5IC/LIؾ)$@1Ht( $HhHCH[]UHHfHnSMLfH:"HH\$0HsHt4LkLO\IsH9t LNI9uI9kuH9s5IC/LIؾ)$1Ht( $HhHCH[]AWAVIAUATUSHHH$ H$(HL$XHN8LD$L$LL$ L$HD$(HT$HdH%(H$1HL$H|$Ht$H~H|$ HHH{pLLHHx.uALL$HLL$@H|$LL(IH 1LD$PLD$(D$PE1LD$@H$1D$THD$0L\$0L9]{LT$0K,DK0DC(ILT$8LUIrAzARL\$xASAvt$0HT$0H }uaLEHt$8A<0uQT$pu HL$xHL$X<u7HD$XS0HsHMPAAWL$H|$(AXAYw|$PHT$8HU:Uw3w}1GjYtpw XtYn ?|$p4Ht$ LD$xL;F8rH|$1H5Ǿ2HT$ HB@J IL$|$pH|$xA|$|$THL$pMMHLdHI$I<$s,HK@ATMAWAH|$(L$p^_up$LL$hHK@s,HD$hAQAMAWH|$(L$0ZYLT$hMt"D\$PM$D\$TH$Ht$p萳HD$0v|$PI<$tl$u$tX$tNH5_t$@AIVAWAUATVL$APL$IHt$HH|$8茐H0u1H|$(LiD$P} |$PHT$Xu:t$HHLHt$0AWAULL$@LD$0H|$([H Hl$p1LHUHHt$0AWAULL$@LD$0H|$(H H$iH|$ILL`HtXH@fvH|$HWt8Hl$pH$H HL$Il$ML$ 1LT$HLET$(LT$@6H$dH+%(t H[]A\A]A^A_AWAVAUIATUSHXH$Ht$HT$HL$0LD$8LL$HD$PdH%(H$H1HL$HT$PHA HtYH|$tQHqLD$1H9sAH,HHkHL9w L9Gs;H]HLL9_rHLT$L9Ww)H9uL|$P1AeLL$L9OuHLgHD$H|$(Lt$(Ld$ I$L|$ HL$AUL9qs.I9Fw(I9Fv"tIHuM~IIA}Lt$(L|$ tIH 1Ht$(H|$`L$Hl$HD$xLLfLMD$8M9rH|$L\$81H5MA HD$HT$8M)1Ht$H$L@L$LX@DHL$H$L$ML$D$H$DŽ$0H9u H߽DHH$蒈DG$AvH5WH臇?tET$0D$7H.HDD$tH5,H<L$H$LӈHLHLH$wH赇$DD$~ H蒇H$ 耇HH$E1ɅtD HD$PHDD$tLLL)H$(MtH$H$LH4H$(ٴH$0HgMt$`L0L$A;t>$>L$0HϦL$0III HHuH辅L$H$HDŽ$8LL9vcA?t]HLL)AM|C|yIMϺA|yHI׸A|yHH$8IH$8H$LH$HuH$8H裳H$@H1Md$XL$L L$$A8_L蔥IHLA>/tH;$(L$0I HuL$@M4(HHL$@LHH$H$LHtIҲHt$@HcL$@HH/H|LIL$I+1H5lLl$LH!LAPLMLH$8QHt$ HL$8xAYAZQMHLH$HWHt$ LL$HD^_$H$8wL LL$HL$@MzL|$HD$@11MLd$HH$L$LDD$D9rFD)1D$ $Ë$A1D$D\$@A1HʼnAtKLڄLIт<t>w'<<$L誃HA<L蒄,LIHmLqLIfL^A<$/EL;$(sxL$0OLLT$XGLIALL$`HLLAQ$L$DD$PHt$ bXZH$2D$ 1HË$HI1HHIH$vD$@L$L߂H;$8r1H5NLMH$@L$J1ҋ$ D)$1Ë$1HʼnH$1胀HH$LL$ E,ELA$D$@Ld$H11MH|$hHt$`E11H|$pLHE1HD$hʧH$L詥E1$MuH|$xtH\$`HL$HT$8LIؾfHtHHLH@H@WYH\$`Hl$xH |HH|HD$(A}HpL$1E1LL|$HT$LA)Hl$@LLVHL$ALB8L$HHD$8H|$L$L$L$$H$H$DŽ$H$jI|$HHl$@HL$HT$8ML,HfvH@M|$MUH$LdM$$H oLL{H$LʣAA}u#LL$ IMMI1Ht$ HLD$ MHD$ LLd$ I$Hu2EH$HdH+%(E111XHtHl$(E1HEHl$HI9SM< IIkHH9*w3H9jwMOLJLJMLLt$1"LI<HLkMM92wM9rsH_I9wIHt$I9ruIM9M*M9jrzILd$M9bvIjHT$0$L$HL$H|$L$L$H7yLE$H$Ht$H|$HD$0vH$HdH+%(rE1LHt$H|$HD$0HX[]A\A]A^A_Hxhu}L`XMtgA<$/t`Lx`MtWLLHHL$HT$8LHtIHiHLLLB0/J|0HKILl$(MUMbhH$HdH+%(L\$(1MCIPhE1,HL$LMATM1HATLt$(t$PHt$0L$GH RHHl$@'M&IvIFLI6Mt IFE1E1H$HdH+%(tHX[]A\A]A^A_AWAVIAUIATMUHSHH(dH%(HD$1uKHw L|$Ht~WMMHAWLHHt$>AXAY|$HT$t1vH2Hw L|$H6Ht0PHLMAWMHHt$ZYu>|$uHt$HD$dH+%(u0H(LLH[E1]1A\1A]A^A_HT$dH+%(tH([]A\A]A^A_HAHfHnfH:"1w^(wDAHI Luu DVAL OcM>AAILuQILu,mÑweHu. u 4tEHt>Hu7Hu1Ht,W(1;W,}"HcHHG H@W(D@1HW RtOu3GHRu A A H‰GH1HWHDHO(;O,|1HcHHG H@O(Ht~H@HpPHWH1_uHƸHs[HGSH_tnuy1HK9_uHHK[HG8TuGHSHHGHcЅy1*K(;K,}HcHHC H@K(HP[1AWAVAUATUHSHH_dH%(HD$1HKH1HIHHuH>Fu IH8DGAwH $LpHHML $M7H$HDU8D;U<L]0McAKDU8AH wU{HHHuFu1oHH]H$IĀ;I.}PHh1PxL% HHHHLrLHH$EQH]DUHHHH]A1ɾ(HHBH$H- H$HqH$HsHuK_tW0 w.HULJLMDRA0A v)HIHu&iDuLELH, DuLIHuHE1L]A;_u;IHL]L*HH;HHH]IHu1 HkHHtL+HDH$DE8D;E<LM0IcAIDE8HD}(Du8DmHHHE8Iu'MJU8;U<>H}0HcL$U8\H]D}(Du8DmH2DSEZA vA_t AAAwB1HD]H]H$IĀ;IHUHLHcH$HH$H8HHH]71ɾ$HHH$HHH] 1ɾ"HHH$[HHH]1ɾ#HHH$1HHH]1ɾ%HHH$HHH]1ɾ&HHnH$HHH]CL}H$IA?IuHLHH*H$H$H)!HHHH$vLsLu{ILkLmCAD}LELH D}L1ɾDHHH$HH}?u H$LGLE?EuHa1ɾLHH@H$H5HVH$H5H9H$H5 H5 H[nH$HPruHsH5 H5 H5  H5# H5: 븋U(;U,@LcILe ID$U(A$,@sL$$0@ @DfED$wHHXID$HHHMDEt LILMDAs@DfE\${_u"HHH]]LELS]LI HIMt3HE8_u'HHHEL-HHIE1L$$ H5@ H$HE8;E<HU0LcJE8H$ % HT$dH+%(tH[]A\A]A^A_USHQHGt HPHWH{@7@HwHs@7vucn@ HS(H;S,HcHHC H@S(H@H@3hHxcuI@vuC1Ƀ{LkPHKPx1Ƀ{PHt5HQ 4HBkP{AH1AL D)ALcIkLHU8 u6@8ru0D[(D;[,}7IcAHHC H@D[(2HhxD9tA1Z[]USHHdH%(HD$1H$HHSHھ7HH>Hr@gH@HttuDGDEHD ACtADpE1ɀxIu HAHELUEbE\$ABILUEtHHU@E(;E,HcHH] HCE(HA0HCDcHSHq@L@Mc M>AAAAAAHDe(HED;e,{IcAHH] HCDe(HXHCDSH{?Lu&HHGHHt+HSUu@x@lt@t1 L@LExlHHHEIHLMA9EIHLMDU(D;U,IcAHH] HCDU(GLcCjLXL]xtuZHHHESxFU(;U,}>HcHHH] HCU(HCE8I;E<}Hu0HcHΉE81HM9BuHH[]A\H[]A\ATUHAQHG8Ju HHGtHLIHu(E1HjHHtAXLH)]A\ Z1]A\SHGuWX1wY‰WXHC8Ft1>HHHKxYuHHCHUHHHs>EuHHsCuKX[AVAUATUHSHGLu []A\A]A^PTu []A\A]A^sDHArHPTHWHtK9/~AC7w7HHt&ET1HHuIƀ>EuHHu HIHH}IĀ?IuHLHHILLH5ApHHG1ɾLHH fuxxpHXH_xTu HHG1DE(D;E,IcHAHH] HCDE(HCQЀ vouNxnHHGHHH&Hu>IHHھHH4ittuXxluRHE1HEtu HIHM9yEHyL1HHuu-HHHEHI1L?HHHIHtZDA2u?LpH56AFM.EHL_u4HL7HHHA4wA3t,1eA^tHt'DhAtEu1L6HAu1\AMpt mA:MHU:_H1HUL]1A;_uIþEHL]H"HMH…tHѾ9HHHѾ7LHMI|$Xt HI@gu~su @su~ru HRI3HLEIA8IuHLHHILL9HL8H$H5L tH5Lu HEMAfu,HHHHIHAn~EUAwt Aaj_H'HHL]IAS%D@LAATu HrHhLHMtp[L HHMuFI]MLH(LHMt_HLIEMtLLHStMUA:Et@tHt!E]8E;]<}IE0McAJ E]8lE1[L]A\A]A^AUATUHSHdH%(HD$HGUNtSpZtkfHHHG/IHt`1H,H/IEHt@Ht L$H$L[HE8Eu&HL$$HE(H1HG=IHuE1 HM9EuHYH]@q@su0HHHMEtɺH5HI@duHHHMÅxHIHutX8GtHEu\DE(D;E,}.McAILM IADE(MaMAHAYE1A}uMUA:)uIBHD$dH+%(LLHD$dH+%(H[]A\A]xtt1PEI=HHGH5HILH`EH1IHU:Iuvu%MW}8;}<KLU0LcO$ʉ}8HHHD$dH+%(uBLHHuIĀ>IuHH[]A\A]HD$dH+%(tFHL[]A\A]ATUHSHGGt TJ]HD[D]HTuLPLUxu NGCLXL]@A_HHHuEHL HH1ɾHH1ɾHH1ɾHH1ɾHH!1ɾ0HHpHux,HxH}D@ATtv3AAtUARHwHHHھH&AVt ArtvHC1ɾH1H$1ɾH1xHt"LHLMxnu1ɾKH1ɾJHHRHM9ELaLe9_4XE1E$E!A$unAt$@St@_t@$ /.}(1;},}!HcHHU HB}(BrHMLaLeHuPAED9~C IQ<$t tIDLHD)LMLMHMHbMtHѾALHpHH>~I1ɾ@gAHHEt{EuuH43N5wHH2H[#H4LCMEAI5HHIAMPLSHM@1@@EH4H؋t/wuiH@Hu^5wVIIMAtGH@LHMt1EAwAwAAwMI1A5@ 11HHHEu;u 8)uH@Hھ[H]A\H[]A\AUATUHSHdH%(HD$1HGH$@80u3HHGHD$dH+%(H11Ҿ.[]A\A]pAHDmLELHDmLHHu1/1ɾ.H8HHtHUHXD8"uHH$HUHT$dH+%(t膥H[]A\A]ÐATUSHHUPIH I$8HH]Hs0SIl$H{@~CID$HK$It$01I|$@LIL$$AT$ID$8fAD$fA~D$(6H{8Ht HSID$8L[]A\UHH SHRHtzCr4d3C΃PwVHclLCA8u\HsH4HsH4 H[H[X[]HSH7HH@Hǃ[USHRHuHHPH@,@X[]ATIUH,SHH9t3LH[]A\HyÃ8/utH@Hu1H@H Ht HPvHzLJ01AVL5dAUIATAUHSH3HtZMw IcL>5w)LHHu5u(HLyHt8/uHuLHuHm1[]A\A]A^1Ht?/uHtHË18u.HGHH1H1>duVЃL6AH`'JtHt$f|$ uHH{H HH{H{H|$0HD$(H\$tAE^EAk1HkVvH<$IvMAkNLD$HHIHw?LpLh1eH|=H5zp=B\#EFA9LkMEQEaA@Ak@uEtF#D\$$E9sfAA fD$"f~;D$8wf|$ LuiIyHD$rHuy|$IvL`LL|$`AH$ HD$`Љ$t 9H<$Ht$8H$MLL$H$Hw?谐H$H }H5HDŽ$LzA HE1A@HL$0l$,u$Ld$0H$@8AHD$ DD$"Ll$0H$PHAHD$ PD$l$Hl$ H|eL$LD$8HLL$HIA:I4L$t#DL$Mf11DL$\DL$XDL$TDL$P#LruI7LwtLd$ 9\$uxMl$H5iL[wu \$XH5iL?wu \$TH5iL#wu \$\H5iLwu\$PyAAD\$l[At'HL$LKmLL$t+T$XHT$ H$t$,A L$L$LL$LdLL$MLHD$H$HT$H$8HpjuH|$tLtT$THT$ H$t$,A L$LKL$LcH<$MLH$LL$HHHw?u L|$T$\HT$ IH$A t$,Dl$tL$L+HDŽ$1HDŽ$D$tHD$l$pT$PHT$ H$t$,A L$LnL$LbL$LLL$H$HHIA:IrL$uAHL|$rHrLrLr,T$E1HDŽ$T$PD$(ILt$@t$(9t$DD$PD9D$(u |$pI7I~at|$lDL$XD9L$(zD\$TD9\$(j\$\9\$(M1L$MAMD;t$tEHl$0ADI|I|$HD$0I|H\$0Ӊ$H$H$Ht$H$H$HD$xЅuML|$Ll$@HDŽ$A[ML$MM|$pIIVMƄ$H$H$H$<_f<_1H$H$H5e2oH$H;$rOH qiML|$MH$Ll$@HT$LvpLnpLfpL^pLIAFH$Ƅ$H$?pAHcƄ<,HƄA t$,LH$L$QH$H\$xHH$H$Ӆu!ML|$MHDŽ$Ll$@D$(Lt$ $LLt$@oH|$oLwoLoo H$D$D$hL|$8/1H$XdH+%(tCqHh[]A\A]A^A_AWH DAPA8AVAHAUATUHSH(t$ DHT$H2dH%(H$HG HD$ HD$0H\$0xHEʁ;ALDMDEHL$N,LD$8LgLT$XLl$HMt HD$ M$$LeMtrH|$ E1H]LmIMt3AG4M}L7nDCLC"nMmEtDDt$T]HD$pHD$@H|$ D$THD$@H|$pHULt$8H$H$Lt$pLt$XD$PLt$`HD$HH$HD$`Ht$xL|$HHD$hH\$hHT$(L|$XHDŽ$H$Hl$(H MAAEjM\IM!I9vPMAWɋ|$ I)LL$LD$xHM9L$H$MGA L9LLLuE1Mt0INIVJ4+LL$LD$x|$ MnM6H$HxtIALLM)HD$(E9EOIcwnHD$(LHpanLLOnL$H$I~ VUt$$RLSAUL$t$H$uAkD8չAkPHAvH$չ LL$|$ 1IL|u H$H\$(H$dH+%(tiHD$(H([]A\A]A^A_AUATUSQHG8Lt1HPHHWH_t Zu6_uHHCLK1A9ZI1HLKмH臠HHt8'Lcu#Hxtw)sHH?H5htrA<$nA=u IA>LcHsHSDAEtE>HHS)H0HDHHHLSA:E ILSA<$EuILcZH[]A\A]HG8_uXHPUSHQHWx_u HHGH1x~ ~Hs>_u HHsZ[]øHW:SHBSHHGBt HJHOBx@ v<_tD@Av r<_u1XE1DPA w Ak$|DXAv1aAk$|A9wLCAuAI@HCA<_u9{8vH[0HE1CAu@tHsADACAEFH H8Hz(DC,Ht8s(DJ01D9}&HcHHC H@s(HxDHHC@Et LRDZ LRDZS(D[H1D9}&HcHHC H@S(LPDXHK9BuDHHAH{8;{<Hs0LcJƉ{8H8H9 [1HuUHSHRH;Ht cHXH[]cOPfHnLOHfI:"G8UHWHtH9rHRH92rHHGE1HtHH)H@ILAWAAVAUATAUSHHcw09wPHH@HIIVHC@tHcs0H{HHUHCHHckPAIHD9[0~VHHKHH@ HtH HS@Hs8D\$ ME4.HWHAVAXAYD\$ DHHAD[PHD[]A\A]A^A_UHSH(wdH%(HD$1~ HPu,~ HHSH}`HtdH}hHtdH}@ueHL$ HT$H}(t H} aH}8aH}@aH}Ha}p~-1HUxH<7dHMxH_UH 91HfHn1H@dH%(HD$81HHt$ fH:"$H|$D$()D$81HHtHHH=FtT$,xHD$8dH+%(tc]H@]H1zcu A<@ƃr@ @AWAVAUATUHSHdH%(H$1HD0E! IԃQHHHc4H>H$dH+%(t\IcT$It$Hĸ[]A\A]A^A_͸IT$ @ H5uHkIT$ @H H$dH+%(tQ\HĸH][]A\A]A^A_,IT$ @b H5uHI\$;Hu2H5uuHDSHArH5duHͻH[H$dH+%(t[HĸHH @[]A\A]A^A_L(Ht$ I\$1HLJ(HI4H"~(FDpH H(fH:")>DH~AH5wLHH[H DAH[;HuH[DHI4IHILAH 5wVMIMAtG`D(H(HH D)BD(HHBH D)JHX@HxH[fLn׃;fL:"uID)$L IT$ @Hx;u?L$$L 2E~MIB|<0u HJT<( @H1 EuL(LpIT$ @LpL(HLJ(u Hd>HWL(Lp_8tIH5reH$dH+%(tYIt$HĸH[]A\A]A^A_ LrHH8/u<H.HH|L  @HM]L L H5,wH$dH+%(twXIT$HĸH @[]A\A]A^A_H$dH+%(tTIT$HĸH @[]A\A]A^A_YH5|nIT$ @H;H5mH޳H$dH+%(tSIT$HĸH @[]A\A]A^A_H5*n藳H$dH+%(tSIT$HĸH @[]A\A]A^A_H5mPH$dH+%(tHSIT$HĸH @[]A\A]A^A_cH5m H$dH+%(tSIT$HĸH @[]A\A]A^A_H$dH+%(tRIcT$It$Hĸ[]A\A]A^A_ڮH(HtaDjEuSHzD@Ai9u;H$dH+%(taRIT$HĸH @[]A\A]A^A_|HE1I|$D8EDXE1E9~AMIILPI;;uHHHHL>I9tTM9uH9uJHvD;\j IcL AHHPDXHHxMZHHHHHt8/u+<趭HHuE H  E1D7D9tA#t1A$uHW E11I1~(L ID$L(fI:"LT$)4$HuIT$ @H|$uL @HL$$L(EH M\$H$dH+%(tvPIcSI3Hĸ[]A\A]A^A_鍬H$dH+%(tAPIT$Hĸ @[]A\A]A^A__~(IT$fI:"HtOIL ),$ @L(D$LL$L$|$L( H貫H$dH+%(tOH(LH @Hĸ[]A\A]A^A_L(HL$ L D$0fInL\$8fI:"H(L)T$ Ht[HW2wMuB AL(IB)\< gNt< B)d<0IL(GH?IT$ @H|$0L(tC @HHHHT(H(L @H@IIT$~( @L(L fI:"D$LT$) $t|$uL @HZL$$L(#fA|$t H5hIT$L L9Bt @H HǩfA|$t8H$dH+%(tMHĸHH5Mh[]A\A]A^A_}H$dH+%(tuMHĸHH5h[]A\A]A^A_EIT$Ht @I|$IHvHH5gHIT$H @L@L/L9@HL9HHIT$I\$Ht @{H藨Hھ @HH$dH+%(tvLHĸH}[]A\A]A^A_QM|$H5gEw3Iwaw H!IwMcB|. uAH$dH+%(tKHĸIcH[]A\A]A^A_H5fƫH$dH+%(tKIT$HĸH @[]A\A]A^A_H5_fLpMt~ IL fI:")$IT$:t+ @HHpUH$H EHR @H^Hpt L$L u H赦>H訦H$dH+%(tJIT$Hĸ @[]A\A]A^A_M|$Md$A72IOH5>L1LVJuA<$uMl$A}u I|$?)MDA<$9uKIT$ @HH$dH+%(tIHĸLH @[]A\A]A^A_"H5jgLIuWLHZHH$dH+%(tIHĸH[]A\A]A^A_錩4E1H5fLhIÅunA<$/u4MD$Mt*A8LuIpH֥H]Md$MuH$dH+%(tHHĸH[]A\A]A^A_L @H%Mu2(蹤IWH @ )H蛤H5LHu9H$dH+%(trHHĸLH @[]A\A]A^A_ H5LRHuS(H*L @H_ H$dH+%(t HHĸH)[]A\A]A^A_H$dH+%(tGHĸLH @[]A\A]A^A_ MD$A89YML$Iy8Lʾ @H<HiID$ @HHP H5(bH;IT$ @HHRs H$dH+%(tGHĸH)[]A\A]A^A_L @H` L @H  MT$A:2u!MZA{uIC8>u (H蜢IT$L=oaLHZH;FIt$u0HN9u'LqA>)t Dž0HQ @H: HVH @' Ml$H5TI}HH3Fu2H[ ML$H @IQ: ]H5LHEtL @HMD$ @HIP Md$A<$2 MT$Az MZA;> H$dH+%(trEHĸH)[]A\A]A^A_MI\$;;tDž0O LkA}u -HvIT$ @HAAqH/Jc4H>H$dH+%(t4CHĸHu[]A\A]A^A_H$dH+%(tBHĸHl[]A\A]A^A_ٞH$dH+%(tBHĸHH5[]A\A]A^A_阢H$dH+%(tBHĸHH5[]A\A]A^A_`H$dH+%(tXBHĸHH5w[]A\A]A^A_(ML$A9Ay=MQEA0tA1t:sH$dH+%(tAHĸHH5\[]A\A]A^A_鸡H$dH+%(tAHĸHH5\[]A\A]A^A_逡E1(HyIT$ @H)HZA<$>u -HFAu [H3IT$ @HfA2H$dH+%(tAHĸH][]A\A]A^A_IT$ @(HŜIT$ @HH$dH+%(t@HĸH)[]A\A]A^A_}H$dH+%(tl@At$Hĸ[]A\A]A^A_eH5<[5H$dH+%(t-@IT$HĸH @[]A\A]A^A_HIT$ @9H$dH+%(t?IT$HĸH @[]A\A]A^A_H$dH+%(t?At$Hĸ[]A\A]A^A_酛H5ZpIT$ @HH$dH+%(tV?HĸH)[]A\A]A^A_1Md$LқHHuHL @HH$dH+%(t>HĸHH5Z[]A\A]A^A_˞ L5YA9D<L @HKD9~ LH芞AI\$Hu5H$dH+%(ts>HĸH5qY[]A\A]A^A_FH5`Y:HTH$dH+%(t(>HĸH}[]A\A]A^A_H5YH$dH+%(t=IT$HĸH @[]A\A]A^A_H5X觝H$dH+%(t=IT$HĸH @[]A\A]A^A_H5X`8IT$H @8H5XH3At$HHH$dH+%(t=HĸH}[]A\A]A^A_H5VXIt$HH$dH+%(tH5UH5UAYH]A\eH5TH5TH5UGI|$u H5T.I|$(HIT$ IT$* & ؔH5TQH5TEH5T9(t 衔IT$ @HH5]THR3H5OThIT$ @H)AXH]A\MLYH @]A\~X]A\AVAUIATUHSHu HmIHȋXu(HPE1:*t,H5SHA֗HHuE11L @HNEt )H詓u[H蘓IUHt @H[H]]A\A]A^mAVAAUATI4UHSHHz0m}ZHUEuH5wLH@7HuEL H )uHM @HL *uHM @HL L(HR @HHǃ(L(H5OHgHULbA<$Hu3H5OHIAl$Hߍu]H5OH*Md$I4A $5w MIAuL @HAL $Md$Ⱦ @H!L Hm}[]A\A]A^AVIAAUH"ATIUHSH1HMt_AzuXIR +wMIIuIuMԊ<(t t HK(HA8E1L(1LHHǃ( @Et )H(HHUHt @HH߾)͐LH߹ @KL([]A\A]A^Ã:2uHBHcPHp͐ @HBHHH1>fDAVE1AUATUSHRHLbLjA<$.D^AC<wHVDAHwHA_tA_tA0A H:.u#@z0@ wHD A0A wHHL)eLOLHcI\{ _LLu{ ZtL'.LLdHHS 1LHȃH‹L1jcHIHH-LILLA;uMu%DuDžDL11LqHLPWLHLHDžPƅXHDžpHDžxHEH`HhHEHEHE)ME}ELcmEAHHEHAEMNIELHH)H9tHH$AL)MtJL,IINHHHHI)L9tHH$%H)HtHLL @LLMHerLH1}HUdH+%(t.He[A\A]A^A_]J'wIIAAA1Du*@w@xt@ot@O@w@ øATE1UHSHHHsI9s#LHIHHHVHvHbHHTHHC[]A\UHSHRHV(Ht Hv0HHC8Hs@HHX[]AVIAUIATUHLSLd$8DID$HtHkI $LD1I9(u M9huA9Xt>HL$0MaHt'IT$fnInLhH(f:"Hf@IT$[]A\A]A^HЃtDUuLFBLÃHvH=9$H2HzËuLF@L@ÃuHvH= $HpHxÃuOHN@@ HHDAtA uHV@0HP(A uLVL#LR(LZ0HIHLLASLD$LL$HuAAAZH<2L9v1H5"L1IAHIQAAIZSHVHHrHSHH)H3 H{HCuH[t0Ht+Ht PHH=YHw=) USRH=  HtH=q HtH=p HtH= Ht1H=+ u1LH5 HLVEL.HFELH6EH$HzH;=O t"H. HJ8tBHJLDxH<HDH|LDHlLDHLDHLDHLDHLtDHLdDH LTDH<LDDH,L4DHL$DHLDHLDHLCHLCH LCH<LCH,LCH<$H9tVHCH<$H9t@HC% H% H% H% H% H% H% H% H% H%  PPPAVH5 H=̵AUATL%NULH-S Ř H 0Hy 1fH@ HfH,@;AʼnHDtMLZHPLs0Dk(HHr e1fH@ Hfp,HG;AHDt=MLHDk(0HLsH E1fH@ HfDH,P:AAIBlHtcHHHLH5 H=0HkDk(Hq []A\A]A^dEH(HuH@S_lfHfHD HQ ) ) vH/ HtH HH@HH H fHUSHHtHH6Ht H[]þHuv"{"ff.AUATUHSHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HT$ H$$D$0HD$HT$HIHI|$$HHI|$$HHtuI|$$ HHt\I|$ $(HHtCI|$($0HHt*4$HÃ/o~<$I<4HuHALELLOIHzL$LT$ L$D$0LL$LT$HHHtUHË$/wBHl$Hm$HuHD$dH+%(HL[]A\A]@LD$M(IhHl$MtLHH~H@LmHLl$LmM vfHuLCIH3HH|L)H)HH|IIIL]MUMIMAL9MItlItYItFIt3It It HUIPH| I<HHt I4HLl M,HLT MHL\ MHHT IHL9hH| I<Ht ItLl MlLT MTL\ M\ HT (IT(H| 0I|0Ht 8It8H@L9 IUHkHHI|H|HH)I)HIIIr'HIMALHIHMAI9Hl$4EUDHl$E\fD\Hl$ _IHH$H\$ $D$0HL$H\$A$ZD]Dll"Ld$I<$Ml$Ll$HLfLEMD ALLHl$eMItrIt^ItJIt6It"ItMUALUKTJTIK|J|IODNDIOLNLIKLJLIOTNTII9KTJTK|J|ODNDOLNLKL JL OT(NT(KT0JT0K|8J|8I@I9-zff.@AWIAVIֺ@AUIATU(SHXLgHL$(AL$ I$dH%(HD$H1AD$ qL$D$,HEHHHt$It$A?LD$@IwLL$(HHD$ HL$HLD$A.A|$$HCDgLLd$ |$I|$ I|$HD$SIH|$LD$0bLL$(LD$HL$A?HIHt$0Iw-D$L\$ AD)|$HCCH5*H9QA;H;|$HCL I4Hv@AWAVAUATIUSHH8Ho(Ht$dH%(HD$(1H^H;o THG0HUH9CHH)]Ls M,LnIHFCHH{Hh(LLC0L)L;C(!|LK8Ht$H{@IL.fInLK8fI:"L9rL9s9H?|H+kHk0I $HT$(dH+%(u{H8[]A\A]A^A_HL$L+{)D$Ht$H{PL|$ FHL$HdwE1M9sHL$L+{LL$LD$HtHk(HC0HH){6{{-{AUfHnATfH:"UH@dH%(H$81HvFH|$HHIHH $H)D$HD$ HwSHw5Ht$HHH$8dH+%(H@]A\A]ÐHLD$0HLHIL9d$ rfETHOHM|E\ vEAIDH< DÐAWLH 1AVAUATAH=[ USHHHt$dH%(H$1LL;LLHI9tx/uH=Z HZ HV u1HZ H-x1L-öHL57L=8HH57LLLuLHV fHV 5HHt.H5c7HXH5R7HAH=HV Lu'H=-V Lu=Z L=V H[PH * HHH X IHLm1HHE0HE8HE@HEHEHE E(1H=W 1W W H5W W HW D^(ELFIAL=DL5zfDW fInH]H=6W ^^^fI:"HW fW zW fuW pW hW HuW HW W HW HW W HW W W ) (W  9W HHyHfL-xH=sUW HRW HSW HPW L-aW JW }(Aƅ HtH5sHtH5jsHtH5Ds qHtH5s Z1EKHL$PHl$D$HL$(AGIHcItH<>@tEHkAA9LD|H$dH+%(H1[]A\A]A^A_Ãl$FLvHt$(H<$LxDD$hL $AA@.H5ıLLL$,H]1Hljl$ H$ILLl$!LL4$lIHH<$11I~PH $LHHD$GDT$ I9IHT$BIAH vA@H|$DT$ DT$ HǾH;l$utLDLcHMuH|$0J<DT$8EIHHD$ HE HHEH;HHuHEH|$0LEDT$8Hl$ E1IJ<JuH|$8J|-LDT$ HT$0IcHItHmDGd4D)Jt(HH|$3H$H8[]A\A]A^A_H<$t+d$$Hct$$H<$HH$H$H@D$$H$EtLL$(-DAWAVIAUIATAUHSHHHXdH%(HD$81HLH} DMEAtwEAM,EtMRLDHAPE1HT$8RLAQLjAWDL$8ARH0DL$A%E]LD$1Ht$0HLDL$AW(DL$LD$wT$0D|$4UEDE1HLD$11DL$LHSDL$LD$AL}LD$DL$M1 DL$LD$HItU]EpH}xLD$DL$EpHH4Hc}pDL$HExLD$L|L} ](CE0H}8E0HH4HE8Hcm0Dt1ff.fH HQ@uHHATSHH$H$H$HL$ H|$LD$DL$,HD$0HT$8dH%(H$1D$TD$TL$TtH$QH50I AD$P|$Ht$X\$(D$LDD$LAeAąF<HD$`Dd$TEt $AH|$`u |$,H|$`u$H|$`u$H|$`u$H|$`uL|$H|$|$(Ht$ H<$HqlDLC(LT$`D\$ht$TqH|$H_HH޿HH5(HL$$H LLHH5'H Ld$`H LZLHH5H q|$hH jH|$hIjLHAH5xH (H xt$;$fF$MYH&HD$`T$h%7 H=H AVAUATUHSH=&1HH=&ILHH={&HHHyH=f&HjH=H[H=HLH=H=IHLxI.LHANHD/HG  L-G HLRHIGIcAHH| ռLIHGI4I|fccFH5A%I|HLD/ǃ[L]A\A]A^H-eff.@ATUHSHHDc(HkEDcC@C []A\@ATIHHuHu HLA\þH|$H|$LDAWE1AVE1AUL- ATAUHSHLHhdH%(HD$XHHD$0HHHD$8D$IIAAA SLI Ik`HNL4 AF@MKIk`DT$E1EjAH4:~HHNvH5#LD$(LD$(DMAVAM A~Ht~L$ Dt$LLcHfI:"DsPKI| EuAEE1L{@LK H}L\$ LD$KALD$L\$ HLHMDA3HC(HC0HC8M IvPIk`HHLMfA[0MfIn|$Lc@fI:"c  L:D ML+=(D M9tL%D L D M9VLD LH+=C MIM!LH+C H9MFfInfl)-C Lc1L|L2HLLHLA9AHL`ADA9wHD$XdH+%(HhD[]A\A]A^A_D$1Ik`|$HDV4O|:L|A?FA{cEL$N|DIMJEIk`t:0fXH HZLk`N42fA~0"Mk`IMA(Iy M{HBMLk`IAB<|$Hk`D @D$uEM9Hk`L\MHk`ID @H|$8,LD$(HH|$0LD$8H2WHHD$0肺H|$0HD$(3Ht$(LD$8HHOLk`LD$(B| <LD$(/L$%E1KI1HC(H}LL$(L\$ LD$LL$(LD$HLXIEL\$ IA~IZ1HS0H}LL$(L\$ LD$qLD$L\$ HLHIELL$(IA/1I HK8H}LL$(L\$ LD$LD$L\$ HLL$(HIIk`HD@@OL$EA@@HLcD\$HLd$HT$HMHt$DKeH}AHHD$E AHD$D$E1JT{LL{HT$@LT$LL|$(HD$H|$ILD$L|$ID+D$IyLD$ LcLL$L)M/H|$LD$LT$ Ht$(IHT$@NfAH|$H2M)LL$IHLLIypH|$HD$!LD$AH Kz@.EbAL$HH@R4H s> T$IHL+%Y> L9L%A> HB> L9H=J> HH+5> HHH!HH+=> H9IrI|$HFfHnfl)= A$-AJMfAD$noAL$L$AD$-Z|EvDIUIk0HE1MHl$(Ld$8ML|2H\$0DӉHI,/HuH:LtIMHl$(H\$0McaME1L ;Pt9ADHLH8Hu1ɉHLH>2;V@ tt$E1N|H|H|ADQH9L$wEM IMIALk`BDAMH}AHE|$D$AuD$L]AE1HL[LcHDCPHCD$HC@LMAAE1AHEQHUHMLH=; LL$L; LL$gAt?E#T$OEL=zCgL\$(LD$@H|$(Ht$P HD$8HD$PHt$0DL|$PL\$(LD$@IMtA?Ht$0LT$8DL$OIc~\,ff.H@AWH+AVfHnAUATUSH|$H=&Ht$hdH%(H$1H$HDŽ$fH:"HDŽ$DŽ$DŽ$H9 )$KHD$H8H=1IHH=H$HL$(HHH|$LE1H$H$ Dl$JL-xHH$藮HHD$@芮Ht$hD$0HD$D$8H^D$xD$ E1L11TD$H$Aăt$H*LL$AQL$_AXtLL\$ED$ AODH;l$L#LL@L肾IHCL9:HL$(H1H$PH5h?LϽH$H9LH+;HMH3HII)LB8L$PH;T$8H5HD$@DzHLl$hH$LH5- I9t(I}I@E9<DDEHkXH $DHXA9vZAPuHwHHLD@8Ex@>@u8HcHMI=& u MH=ՠHH5H=% HeH!IHM,$MuAnDC@":wHHLDhIAMuM;,$L ;IL购H5$ 11H=`dfInǀ=% HD$0fH:"H)D$ u ILd$ bLd$ H55# LIګMl$HIUH=# Hu"H 葪L>M21H1I辭LtHD$8dH+%(WdUHAWAVLxAUIATASHHH}HEHPDLH DL(HdH%(HUItLHUHUH8H.LΩIHpIIHII)L9tHH$AL)M1H|$LLHLmL]HULH8IHEH5A.optfAGsHGL]LmEHPHEHJ}@H]1L|DHH}莘HUDHHH0赧DLHPHhLAIkXL%`LtXLHHHhHH}jHuLD|H@fLPLE1I.袋MM)IXIMIAlIIt|ItbItHIt.ItI:MDIXI:M0IXI:MIXI:MIXI:MIXI:MIXI:MIXM9IzXH?IIIXI:MLHMtxLHMtaL`H`MtJLHMt3LHMtLhM9t!I:MFIXM9t MIMDH@1DHkXL`IHDžXIL4NIIIIIk`HD>IXM9MI>I]I$yIIvDtH]1HA9#HkXHrH HHwHkXHL9u I`II:I?1 _I 1GAfnLIH{? 1DHDHA9H{ 1AHDH=s1HCHHpHC HsI>tZI?kMyIHRIc4L>拝tHME1D9IrLkXN;\tzILX(IhDtH}1A9HLkXN;\uIIItI`MkXIISHI9WH$H`tH`HyHtLM1L9;LFMkXK|uLkXIWHMIAHH9EIv)IwI>IHH=H=H?HXH>9r= ubE11AIkXLHXH t9wEMkXL@IXIz AE9w9E9HhH H0HtHhH)H;uLաH8YH(LetH L  HUdH+%(=He[A\A]A^A_]IyH7AMt5I~H'I>>u H? JLHXHXH9=HQHu H?HIQH‰4L]D|L]DtE1]HxHLXyMIyHtkHXH9=KH>>HXHHH=I>IEIy RbafAWL=AVAATAUHnXSH%AIIAuLk`1CD>uhAHXE91HEHHvH=h!H=wUH=?w~H==H=wYH=v1H9]@vLW L+WIHD L_HIHGH=H1Hv;H= /H=1H=>vH=tEH=`1mH=Hq`H1B1;141-1&H[]A\A^A_1fDAWAVAUATL%iUHLSL} HdH%(H$1Ll$@Lt$ LLHE@H}HLH_\HD$H|$HU@EhH5LLH5H=辟HLd$`HLHL$HHt$@LHH $H $HHH$L$LH5HHI}HLLH;LHLH}t-L$HH5OLRHLL返L跔L诔H$dH+%(H[]A\A]A^A_HH$HLH<$LL$(H<$1Ht$ LLL$Ht$HeH|$HHT$1HMDH5rHH|$`uR}@~K}D~E1x5}D1x"EhH$L$H<$ɓH$H1LH|$Hھ LHH)H$HLHH|$H$H$HTHT$HH5HHLL$]H%LHH5hHmHLLH&LHH|$ܒBfHGATIUHRHH`HHTXHL]A\ ff.ATIUHSHHdH%(HD$1Hu HI)L$$Iw6H;LHRH $HHK HD$dH+%(u#H[]A\H1H=HH$HCkff.HHtHtÐ@QH>H?H9H9vHH9rHXxLHHH9}AUATIHUHSHPԙAD$LID$IHsID$I$L*LHL<HSH3LMZL[]A\A]fUHGSHHHt$H9H9T$v7Ht$HHSH3HHHRH躐HL$H+HKH[]ÐfDAWHAVAUATUSHHHOH+H9IH7E,$H)Ht$L4H<H)H9r>HHD薖IHt5HLHILH)HH[]A\A]A^A_HfH?H+GH9fATISID$QLOH?IH9tEIL$H9w"Ht LI<$I\$LZ[A\IHL1LI<$ֹ@ATIHHPIT$I$HHpH9HxI $I|$L@H0H@MD$@LA\ff.ATIUHHRZHH?H+EH9XLH]A\AWIAVL4AUIATMUSHLH)HWH(HOdH%(HD$1HHL)Ht$HD$H9HWHt$LHHtI7HHMMtMtH|LL3H|$LH|$I/IHD$dH+%(uH([]A\A]A^A_úzE@HHIHvH?LHH9IHI9t.HLPHHMXLXHt%I8HMPI@HHHIPHPI0HݐATIUHH$H$L$L$t@)$)$ )$0)$@)$P)$`)$p)$Hl$ H$1dH%(H$1HHT$H$1҃ HD$$D$0[L11AIHHA+H$dH+%(uHĘD]A\轖ff.H7G@HGHGPGTGxLJHLJfLJHLJGWGHGDAWHHAVAUATALEUSDHdH%(H$1H$H趋uD$H$$HDŽ$DxAt u^= EAv-H=JLDIHt8ox$ $zD E= $@9= HG 5 3 u1H$dH+%(H[]A\A]A^A_H=KDH誗AǃE~= t3HPKAMkLjhE}DQ EH$ACDd$@$DkHl$DLkLt$L5JLc<$Ik H5 Ht$ A܅DEbA9tBDL腔ADŽ*LpvEVD)xLT$ EZABAue$,$lDd$@Hl$Hc$H5U DEtZP={ D EAAD$EVt 9$uDd$@Hl$EtD$$D$AA c AL=R L<$Hc$u AOH<$D=[ uL V MH= L$H0 L$HDŽ$3H<$Hn H= =B tL$M=. $$DH<$P HHL=E L-n Mt A}D_H5NLHc$A}CL[I4R LHHL܋A}CLxH5MLID轋L]ОHhDH<$H D% AyA$H<$]%L5 HDŽ$MqL$- IH$L-a Z L,$=M D8 EI$MFhLL$C,فHkI~hD'hAMkMFhE 11LD9qEhLA裏Iąy݁LkMVhE:LD~DHE MA$ovHuovI9u(D)I9D11LqA9sE|$|$(LD|$(I뉋MLΉL$(|$(HlUIйHH]H-f.AWIAVAUATUSHxH_Ht$HSxdH%(H$h1HHCXH+KpHD$ HH{pHkhHH9HIL+K`<LLd$L]D$<HHL\$H!D$0IL+C`D$M9HFH|$p1E1fHnflChM,$LUHAUu8HKpH9Kx:LSpA}IMZL[pA:AUQ%uAm@>@<U@=HSpH9SxLCpM`LcpAA;LKhHkpL9QHKxHT$DMeHE^LEHH+s`D\$(HHH!IL+S`I9HFfHnflKhL EmChDL$A|$<DL$HD$0|$L$H|p|$(LT$LJI4Ht$@HtpL[pL9[xHCpA$LLhLkpMl$AuDLIH@.A}HKxH{pH99LWLSpL[hLcpM9HHSxLD$@DL$HIHHH+k`I!DL$LH+C`H9IFAfHnflShM@R!@Q@m9@} o@' @t@%HKxH;Kp>LkpIuHspAEA;HkhHCpH9HLCxDEvH|$LT$ L-QHHML+c`H!IL+K`M9LFfInfl[hH,1JDLM_$IG$L\$AJTpHu`I8Ht L/LAUHDH\$AG@I_$AG H$hdH+%(?Hx[]A\A]A^A_D$_L1E1E11A2@qm@+p@lu@#|$_toAGCH5@|$OLDL$HDD$@L$@w[EUIG0HVAARHT$oRLWLHt$8H |$_t.ACL <|H5ELID聃H5LrLCpL9CxHKpNdpHyH{pHshLSpI9LHCxMIIL+K`M!LH+S`L9IFƒfHnflchI4$E\HL$HqDA/EALVDIGAH5)gH1̆M_LI虂LD$|$_Ip[/sAƒLVI2HL M$|$_?D$_Il1ACL%zH{pLHHkpH-!HхLKxL+KpIL9H{pHLILcpFH-H蕅IHCxH+CpI9H{pHLH5LLcpACLcpHHQHSxIL)H9PH{pHLILCpaDt$(jL{(A~tk@AwjaA9-HT$0AT$L$fHnfH:"D )$u911LyAOPfo$A_Xfo$AghAGTAowXDH$L)$Aoh)$#Ll$0$DŽ$IuL$DfCH5#@DH5@DH$ H5 @DH$(H5@DH$0EH=T>LtIDH$81A A E  HDŽ$PAwH$@D$Jf$H$KtH$PM"HDŽ$XAwx HDŽ$`AwtH$`"HDŽ$hE1Lt$E;oLt$1MgxA;_xH$XH_L$`Mt A{H$PHDŽ$pHs_H$pH|$ ""fn$H|$ LE1fpf֔$#HtGD;ksADHk8HًQAfDnfD:"9H|$ LAfD֌$Q#1H)L$pM AmvI}H H#ӄA}H$`IuAH|$`"H$`E;esRHKDHE|D;zhB $JLL8M9!ED D9.AHDSE1EAIA9 H|$ "DcEAt$fEfnl fA8=f~"AfDnfD~$hoH$D$hD E9~E`kxD$hDŽ$lti$H$IHHtJHD$n" LƉA9#Et$J(AB 9HD$0H$@D$8MH\$pL$`Mtl$8A;n!H|$`!H$XH H$PHt{$9L|$0Ht$HI?H$xdH+%(Ll$0I}HĈ[]A\A]A^A_McIAK\73H=4L$1LHʼnAosH 1H$HHD$ Ms311L$ LLT$2sH$H9$H;${L\$LL$ H;$ L$PLD$`Mt AxHsH|$LL$(H$Ht$8Lދ HL$HD$[H$pHt$( \$ LT$LH$@A D$HfDnd$ $x$fDn$LDd$@D$fD:"$`fDn$|fDn$fE:"fDT$(fD:"$fD:"$fDd$PfD\$fDl$ 9$$Dt$Xt$X}Dd$@1ҾH$PHD$(LT$L$PHT$ EHIk8EYEXIL0ID!Ld$8Y H\$PHALQHYHQ Eh0M`8AL|$0A "\$8AD EtHD$PLt$@H\$@H9\$P} D$8{HL$@H$ΉL$XfLnHD$(IA)D$H+L$1L$XLLD$AML$Dt$DLIeL$LUw$J|$XE1D$hA)E9 LA$HH|$ ?!H$H$l$(HD$H|$D$hH\$xH$XH D$lH|$l$(D$8 11LL Hl$1HHD$@zH57L12t$H|$(L$fo\$HA H$DŽ$$)$D$l$A9A9L$D$L$D$L$EE$HtCH$LE11H+$VAt$(E_AXLoH$LD$7DA HEIA ?A tD$|$DL$t8H;$;H$3H܋$pLrAWT$L$LwH$PE1HAIHXqD9LA{AA;EC D9vI8A99 $\$ED[T$(9(w9h  DHD;L$(| ADL$(AH8A9uҾ LH$ $lD|$hD|$Ld$_Dd$ LH$ ݃;\$(}^PDAt$ELgZYtD$LDDD$)$HcD$u}H$~xLD|$hLd$$IGH$PE1HDŽ$pHD9PEIk8HHz8HAЃL$AT|H$L$H$@I}ot$h;sL$hHlHuH} T$XHt$xH'H\$ uH/tuL$t$H|$pV$|D$@uHD$DD$D$suLsHD$D$$|$x H$pD$mDUÍPD9Ut+HT$$H$ $5H|$pG$Dufn$@fn$f:"$$f:"Lfofl)$ sHL$$$H$  LL$uH}A YuDD9uLD$rHt$D$H$ $ASM D$H|$ A9AM‰P~$pH|$f~HHUH]8fּ$H$H$z#LD$fo$~$HH$A  fS$`H$$HCHL^Hs K,L[0AH|$C(H1Ҿ1 1A‰$J4Yc$HD$ALHt$FDPDVH\H$XD$hA;mAO|IwI;]ANdMA4$LpIt$I|$D$A~<AAt$LpD$E9H|$ LD$D$B;]!LlMtI}Ao8LLcӃOLI)Lu-pL$L;$uBuLpL;$u-H$X12L$XEXAsApKl1AH$ }A9u DUADH}H sUuvQnhH$XHT$zuH|$nLD$Ax L1D|$(l$L|$A;_AKlEP9UH$PD}DM t$(HOHt3;ws.DT$D;uD;yuDD$D;A u D;IH8LLDDL$xLLt$hMIl$xLl$XA݋$9}1DLl$XLMLt$hLdH} H$-O|D[D$AxAIWAȉ$AA9[Wg$H\; ;C;C>+EoE9/ T$XH$L=L$LLl$hmH|$+.H$+\{LE1<IOH$B4)I0{M_IM9rH|$hH$L$XH$PH|$`H} DLLLHuH$gLE($+DB ?L$(9L$AMˉL$(*UH|$ D‰~$pla.DUSHRHGHHUH9U 'HMHqHu H{CALJX[]ff.ATUSLgG@A$LG I$HHEH9E HMHQHUHsI$HH*kLCIHwH;wH;w HwAǀI[]A\mUHdH%(HD$1F H3HHc H>ဿ.HD$dH+%(u7H]À_H=H5*1DgEk@-u= HHff.AUATUSHH(dH%(HD$HG(ILHHHHfHnHfH:")$L$$Hk(MVH|$JHtH}yh0HLk0MtI}Zh0LHHH;9hHD$dH+%(uH(H߾0[]A\A]jff.HW H8wHHHH9rfÐff.HgATAIUHH$H$L$L$t@)$)$ )$0)$@)$P)$`)$p)$dH%(H$1H5Hl$ H$H$HT$HDHD$$D$0N1HAILHM(H=C&rff.fAWAVAUATUHSRHHHtHHuGH}PfH}HEPHH}efL(HEMX[]A\A]A^A_HkSXHH9BtJH{HXHt hHCH{Ht fHCH{PHt1eHksXH{HH<@<Ð7f7f7fAWAVAUIATIUSH(dH%(HD$1HHZeHMH-]Lt$ L&L|$#E$IT$ADDMIHHuHD$dH+%(uH(LLL[]A\A]A^A_VafHff.SH_]THHKfHs @p { DCfx D@[DFf9GDG N 1fA9ATASQ0eHtZ[A\HDH5&H}dHAUATAAQHf?]UMAAXDHDA\A]wAWAVAUATUSHXt$dH%(HD$H1HD$IHwH= H|1LH{HtLoeHXL9uH+EHc\$H;]8HMPHyLE@IdLL9;Hkd1IH9ALkMkNT J;\)I IzH9HfHnfH:"U0HLd$ Ll$fLLHg5H9]8rHt$LHgHT$ HD$HL$HdH+ %(HX[]A\A]A^A_ÃHHmIZHH)Hl$H\$ H57LaIH`H=VH-D}HEXHH}t'HoHXH9tHHA9DB;UsHHuH}LeHtdH}PfLmHE8E(HtGAH=D}LEH EEQDT$ DMcILMkM;K|7HtLcu;\$ tkCt7pH|$ 1ɺ YHct$(Hu@EHGL9w6Dt$AIkLT1I;@FH:p8EXMkNT9!fM0ZbRfHHHHHHXBHBBBHBBHBH9uH Xff.fUSHQH1bH{_HS H9S(u'HHҽH{HEHRHk HHCH{(HKH)H{aH{H_,Hk(HZ[]ff.AVAUATIUSH/HHDmDuAE9t+D]oIkAsuHAHkHi[]A\A]A^À}H1Ҿ.HHkIAHQI$I,$D0Dh1Ҿ11HHkHiQI$HI,$UUfHnSflH8dH%(HD$(1)L$D$)$H)HcHT$aHH+|$uD$HT$(dH+%(uH8[]_fHwDOHHGLF t=AUATUSHO HLAHAFL []DIA\A]HD_LGHGDșAA)G DDWfSoHHoNыV vOH8C [@AUATUSHQH/HtTM+M9u7Hu>1L#WLIHk8AHODHHX[]A\A]Å부}HDmHk8IHAHOHD Dh볐@AUATUSHQH/HtVM+M9tX[]A\A]Hu81L#AʼnLH4AODHH0뿅봀}H_DmAH4HANHD DhwAWAVAAUATAUSQHhEEx]AAAADH\DHH\H9Htx}ow*AZD[]A\A]A^A_AMkLchE$$DHDHAA8uDHH_DHHA_A;A돐f.UH1ҾSHPKHHuBHJHtZ[]fH)HuGNH)Hu@@D?@SHH?HtUZH[ff.E1 AuDfQHc~6T7Hу t tLcBTу  tZÅuZsff.G 9uÃUSSHu$Mk pH5#HcX[]HHw0H:UL LcSLI)K4}CAYH[H]yUHs(HH;AZ[]fUHHs H8A[[]SULHsI8AX[]@UHHsH:Y[].Uff.UHSHHHT$`HL$hLD$pLL$xt@)$)$)$)$)$)$)$)$dH%(HD$H1HT$PH$ D$0HT$@D$40HD$8=ZHt$0HH$Ht$HL$HHD$HdH+%(u H[]ZfDATADUSHH9\$(8u1HLL9$$u 9\$HT$HdH+%(u HP[]A\1Vff.f7AWIAVAAUEATUDSHxHdH %(HL$h1ɀ L$H$D$D$Ld$ 1L$LLD$HT$LLT$S H|$$DS H|$(HS(H$H|$0S(H4$H|$8S(Ht$H|$@S($H|$HS $H|$LS H$H|$PS(H$H|$XS(LD$Ht$@ILLDhHT$hdH+%(uHx[]A\A]A^A_,U>UHHHH]Rffnf:"f9Ã9ÐH1H9P~9tw;t w 1Hff.UHSQyHkH_hHTt?HSHAHI9WHƉTuIAE+CT9Z[]7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7f7ff7OOOOOwO  uMUSHHH8u 1u.H[]'fD1Ét9u +u/E11H޿1BO1tÐH1[]Ãtuf.fHe8tf1u@H1NH8tfuÐH1wNH-HHfUHH]5DHHHf.HSHEHHtLHt[HHf&f.HHH fUHH]DAWAVAAUIATIUSLH(LIt$HL$`HT$hI9t@EHA*tmLHT$HL$LL$D$ND$LL$HL$HT$u:HDrML1H9DBH(1[]A\A]A^A_H9t;H}ILHHT$hDHL$`LH@8H([]A\A]A^A_f.IqI9t.A*tLHT$HL$L $ML $HL$HT$uDr hI^BRf.UHSHH(I9tH{HHH@@H([]DHHqH9t,?*tLD$HL$HT$jMHT$HL$LD$uH([]f.AUIATIUHSHHu%H{LLHHH@0H[]A\A]DH[]A\A]f.f.1f1fUHH]DHHvH9t1?*tHjLHf.DUHAUATIHHHHPHXL`Lht#)p)M)U)])e)m)u)}dH%(H81LIHHHHH%H)HH9tHH$H9uH)HumLl$HELDž IH H(H@LH0Dž$0 LIAHLH&%HLI %f.UIHATSHH)HĀfoCdH%(HE1HEH/): )pfoaCHEH)EfoZCHH%H)H)EfoNC)EfoRC)EfoVC)EH9tHH$H9uH)HutHEfoUHLLd$fo]foeIfomfoufopID$`I|$hA)T$A) $A)\$ A)d$0A)l$@A)t$PDKADhL!HLf.@UHHAUATISHHdH%(HEHH9tHH$H9uH HL$L AIL\$IMSLאHHIHHH4HH)AHHH wI)MI9w/M)LLIseJDHUdH+%(uHe[A\A]]øHf.fAVIAUATLd7USAL9(HIH#DEHHtsL9<%uCH|Hf.DUHH=Ht4HxHLHH@xH)1HL]HHu! HHǀH9vHH9sHgHf=f.HpHHFHtpLDL@x I@HBHHHIDHIfHFHFHcHFHHFzH11fDHMAIL ExEfDH11ɐDHMAIL Ex?A@IIL f.@HDG(dH%(HD$1AD<tkvAHH<uJHwHWHD_H$HT$dH+%(uGHfDu=HH<tH6H1;f.AUHATUHSHHLoHT$Ld$I@11@AUIHЃHH ƄxHt%HLHH tH[]A\A]H1[]A\A]f.@tMHp0tKw uV@u#VfD` Pu1VfDAU1ATIUHSHHHt1VHA<$Ml$@u~HCAEIu1C(@HD$`H9wL9$2D$ to@L|$xHunMtDl$ AuaHt$HT$pH$H$HH$wH$HCH|$w>DH$LD8M4MxD$ D$0H|$ Hm\$ Hl$8MIL|$ LE11UHHЃHI DŽx?w@tHHI HE11D2HHHI @x?w@tHHI MthmT$0D$ t ML11HH$@2HHHH @xHtJMNl5DH|$(LHHtMtHT$PLtMHl$8ML|$ D$ &D$0u H|$OEVHT$PH|$(LL[D$ MHl$8ML|$ @L|$ Hl$8;H(D$ D$ NH|$=fDH$HC tHCHD$PH@3HAVAUATUSHH@dH%(HD$81x)HCH{LkkHD$LcHf.DPXH9H(HHtH]HfH)H5HÐPXHHfPXHf.DHHtHŨHfHHHÐPXHHfUw(nuHFHn HtHH]@]H~DSHGHwHWtHCHCH++CCUNGHCHHCHC[AUIATIUH)LLH@Hh`HOHl'U(H8@Ht2HԼHOPHHv HHoPHVH'3H_(HtHWpf.fHHÐH@ATUSHdH%(HD$1=Ū+(HHh1HL$}*D$11HHi$0HH=),IH V1T$H3t;Hs/H H=+*1D$ u fL8/fDH1-H=+H02 H H=\+H0+fDHGH?ATUSH7HGH9HHH9wWH~HXH]IL@@HtHt}LHuH0IL;%\~[L]A\fDHH9HBHS9HvCH9s>HH?H)H9HGH{ffEAD$HHEMI$ADsH=* DH]UHHHHGHxH;=u H]@Hi:tPJH׺P@UHH]f.HHHifUHH]f.HHH)fUHH]Jf.H՛HHfUHH] f.HUUHHHHGHxH;=Su H]H):tPJH׺P@UHH]f.HHHifUHH]Jf.HHH)fUHH] f.H͙HHfUHH]f.HHHfUHH]f.ATUHHH˘HHHPHxxH;=ǟu%HEH]A\Ð1HEH]A\DH:t @fDHHIf.SHcHdHH[SHCHlHH[SH#HtHH[SHH|HH[ATUHHHHHHPHxxH;=u%HEH]A\Ð1HEH]A\DHq:t @fDHHIf.SHcHHH[SHCH$HH[SH#H,HH[H?SH9wtHH9vHH6H9HBHC9H=vGH9sB%HH)H?H9HGH{ fDHHX@[HHyH=s%USHHLGH7HLUHHL@HtHt(LHs*HIH;-u HL[]CH;-EHtELHUDH[]f.ATH)IUH1SHHL@Ht,LHL.*H;Iu#[L]A\f.A$H;|CtCLH+D+[]A\H97tSSHVHH~HFx$H-H9uxHHzH9u,H3H[1HHDHٛ8t$BHJHt$]Ht$fDB@H 9t Fsgf.DH;=}ufHY8tGPWfG@H%SHHHHFPHxxH;=uHC[@1HC[H:t @fDHHfDATHvIHjLA\@HHHHFHGHHHFfDHWHJyBHNyyAHHHVf.fHSHHHHFPHxxH;=uHC[@1HC[H:t @fDHHfDATHvIHjLA\@H]HHHFHGHHHFfDHWHJyBHNyyAHHHVf.fATIUHHHHHtGHH$#HtH9tH2ID$H]A\DHHID$H]A\H=!HJSHsHđHH[SHSH̑HH[SH3HԑHH[SHHܑHH[ATIUHHHHHtGHH$"HtH9tH2ID$H]A\DHHID$H]A\H= HZSHsHHH[SHSHHH[SH3HHH[H6HVLHEHHf.SHHPHxxH;=uH[@1H[@H:t @fDHHfDSHHHH9tHt H[fDHHH[H=f.fSHHPHxxH;=kuH[@1H[@H1:t @fDHHfDATH6ILA\fHHxH;=uHѕ:tPJHZf.P@HHHHHHHJyBHyyAHHATIHdH%(HD$1HHPH4$LHVJH$HxH;=#u!HD$dH+%(uEHLA\H:tPJHjP I]AUIATAUHSH^HIJ<#cuI|$u!IT$@HXHHPHHLI]H[]A\A]H#DHH=|HHPf.HGHGAUIH5ATIUH dH%(HD$1HHKHL[LHLLHHD$dH+%(u H ]A\A]NI>fAUIH5ATIUH dH%(HD$1HHHLLLIHLLHRHD$dH+%(u H ]A\A]IHHHgUHH]f.HcHHAUIH5ATIUH dH%(HD$1HH;HLLHLL%HHD$dH+%(u H ]A\A]IfAUIH5xATIUH dH%(HD$1HHHL;L3LIhHLLHBHD$dH+%(u H ]A\A]#ICHHHUHH]f.AUIH5ATIUH dH%(HD$1HHHL[LHLLHHD$dH+%(u H ]A\A]NI~fAUIH5ATIUH dH%(HD$1HH[HLLLIHLLHHD$dH+%(u H ]A\A]IHHHgUHH]f.AUIH5(ATIUH dH%(HD$1HHHLL#HLLEH}HD$dH+%(u H ]A\A]I.fAUIH5 ATIUH dH%(HD$1HH HL[LSLIHLLHHD$dH+%(u H ]A\A]CIH3HHUHH]f.AUIH5 ATIUH dH%(HD$1HHKHL{LHLLHMHD$dH+%(u H ]A\A]nIfAUIH5( ATIUH dH%(HD$1HHHLLLIHLL:HHD$dH+%(u H ]A\A]ISHHHUHH]:f.AUIH5H ATIUH dH%(HD$1HHHL LSHLLeH]HD$dH+%(u H ]A\A]IfAUIH5 ATIUH dH%(HD$1HHkHL{LsLIHLLHHD$dH+%(u H ]A\A]cIHcHHUHH]f.H#HHAUIH5 ATIUH dH%(HD$1HHHL{LHLLHMHD$dH+%(u H ]A\A]nIfAUIH5( ATIUH dH%(HD$1HH[HLLLI(HLL:HHD$dH+%(u H ]A\A]IHHHUHH]:f.AUIH5HATIUH dH%(HD$1HHHL LSHLLeHHD$dH+%(u H ]A\A]IfAUIH5ATIUH dH%(HD$1HH HL{LsLIHLLHHD$dH+%(u H ]A\A]cICHcHHUHH]f.AUIH5ATIUH dH%(HD$1HHKHLLHLLHHD$dH+%(u H ]A\A]I~fAUIH5HATIUH dH%(HD$1HHHL LLIHHLLZHRHD$dH+%(u H ]A\A]IHHHUHH]Zf.PX1IHHщHH= HHH7HDHH@HHH@@HHHHJH9rRH=qH1H?HHH+pH9rPHfHH@H)H9HGf.HAH9w H@H9ADf.DHtHufHtHufIHtHuDL DDH)HtHuDcf.H)HtHuD3f.H)HtHuDf.H)HtHuDf.H)HHMf.H@HHHf.HHHHHHHHHHHHH@@HHHRHf.@HHHfHHH@@HHHRHf.@HHHfHH@@HH@@H?ÐHH@@HHxHH9pr HHH 4 H> H= DHHPH9sHPH=1 f.HHxtÐHH HVH=B mf.HHBHtHDf.HH HlH= f.IHATII1LfL9w8I)I9LGMtHItLLA\LA\LLH5,1H= fHPy@HJyBHHATILA\f.fATILA\f.fHHHAWAVAUATUSHL/IEHIH9vsIILI|H)HL$I9wYL)HHtID>ID)HHt+LLHS tOHD$H{H)I9wHHuIHL[]A\A]A^A_DH9ILCL)IH6HNAUIATIHUH LHL]HA\A]ATISHHHCH9s H)H<@H?HH)HLEHL[A\AUATIUSHL/IEH9w>H)HHH9HFIHt&K|%HH tID$MtIHuHL[]A\A]IH6HNpAUIATIHUHLHL]HA\A]@HHHyHtHHH9HF@84tHsf.HtcAVAUATIUHSL/HMuDAtHLHu"HI9w[H]A\A]A^fH[]A\A]A^Hf.fH6HNpAUIATIHUHLHL]HA\A]@@AUATUSHL/MeMtNHHtFIHI9LG fDIrCt%HHHtHL[]A\A]fDHI[L]A\A]H6HNpAUIATIHUHLHL]HA\A]@@#AVAUATUSL/MuL9sHIHHHu'HL9t'AtHL6HuH[]A\A]A^D[H]A\A]A^H6HNAUIATIHUHLHL]HA\A]PHHHH9rfDHH9t@84tHDHAUATIUSHL/IEHt5HHHH9HFIHtCt%HHEHtIsHL[]A\A]f.fH6HNAUIATIHUHLHL]HA\A]PHHHyHt%HHH9HFfHr@84tUSHH?H6H_HnHH9HFHt u H)HHMH[]fUSHH?H_H9wVH)LH9HGIhHH9HFHtHL?u H)HHMH[]HHH51H=>艹fUISHH?H_H9weH1HnI9wtL)H9HGL)L9IGHH9HFHtLLu H)HHMH[]HHH5$1H=HLH5 1H≠f.fAUATIUSHL/HI]HH9HHFHtLLu H)HHMH[]A\A]@AVAUATIUSL7I^H9w`H)HIH9HG`H9HHHFHtK<&Lru H)HHM[]A\A]A^HHH51H=o躷f.UISHH?H_H9wRH)LH9HGLL9HFHtLHu H)HHMH[]HHH5g1H=*f.HE}@GDGG@G@H;=vufGH7D7HGH?SH9wzHH9vDH6H9HBHC9H=vMH9vH%HH)H?H9HGH{fHHX@[f.HHyH=IfDHuH |L@LATU1SH0IL@Ht#L@HtIL;%uu[L]A\@hf.AD$I$ADf.SHH11\H[SHHH:H[D@#׽H;==uufHu8tGPWfG@HdH%(HD$HHxH;=tuHD$dH+%(u>HDHt:tPJHHt$MPUSHHdH%(HD$H@H~8H-QzHxH9uPHEHHD$dH+%(umH[]f.HPH;tt@H@Hs:tPJHHt$Pf.DAWHIAVI)AUIH 0ATUHSHH(dH%(HT$HLbHrMI)I9wRHHpLt$LH $LnHH $IL@t1H3L@H LHHL$H$HL$L $IMuHHH-xHxH9LI9HD$dH+%(=H([]A\A]A^A_fH J|-HLILLD$L $LD$L $@LMt%I9t II4K<(ILLH-DxMHI9bA@MxC8Ef.AAMKfDHq:tLPJHLLD$L $jLD$L $@H-wLMHPf.DHHPH;fqtL+HIt*LLIHPH;Ydu[L]A\A]A^AE@Hh(LH5H=1ףAUATIUSHHtvHIH?HXH)I9HLH;XH9w HPHH9vIHL>I<$HItOLHI$HPH;~cuTHL[]A\A]fDLHH)I<$HHIuEf@~Hg@HXH=YATIHUHHHHL]HA\fATIHUHHHHL]HA\fAUATIUSHHtdHIH?HAH)H9wuH,H;iwA~ HLI<$HIt2LI$HPH;buHL[]A\A]@@Hh(H=!f.H?HH@H9w)H9wrfDH)1HH)PH=<1DAUATUSHHHLhMeL;`w@~ LHHHP@,HHPH;auH[]A\A]@@L`BD(H[]A\A]@AUATIUSHHLhImH;hw@~ HLJI$HPI$HPH;`uHL[]A\A]@HhBD(HL[]A\A]ÐUSHH(H?dH%(HD$1HGH9Gr G~)H;Hl$H1H)HHzH;=`u!HHD$dH+%(ueH([]H _9t$JqrHHD$rHD$JHt&qHD$dH+%(t$HHKH H([]H5DHHf.@GxH;=&_uHG1fH^8t GfDGŐSHHdH%(HD$HPHxx(H;=^u/HHD$dH+%(u>H[fDHt$1fHi^:t @fDHHifISHHIPHxxH;=5^uH[fD1)H[@H]:t @fDHHf.@ATISHHdH%(HD$1H9t0CH{HSxCHcH9I$HzH9u>I$HD$dH+%(HL[A\Ht$1lHHRcH9]8tBHJHt$B@H ]9t Ch\fH7AVAUIATIHUHHdH%(HD$111HT$I_LI$HEHpLLLLjHLHD$dH+%(uHL]A\A]A^KHL,H @ATI1UHS1HdH%(HD$1HT$LI$HEHpHvӾLFHL+HD$dH+%(u HL[]A\HLHc ATIUHHdH%(HD$HPHxx3H;=T[u:I$HLHD$dH+%(u=HL]A\Ht$1$fHZ:t @fDHHHLH fH9tGATUHSH1H)HIL@Ht3LHH%IL;%Zu)[L]A\ÐHy`L@LÐEAD$DAD$I$ADf.SHHHHZH[DH9tgATUHSH|H1H)H'IL@Ht*LHHlIL;%Yu0[L]A\EAD$DH_L@LÐAD$I$ADH=ͽf.DSHH>LGJ4L9wHH-H[LH5H=1SHIHH>dH%(HD$1HOHH)L9IGHHH9w)LD$HLHHD$dH+%(uH[H5H=;膘ATHL@L9wIfLA\LH5}H=1HSHH>IHOHH)L9IGHHH9wHLH[H5 H=1SHHHHH[DH9tgATUHSH|H1H)HIL@Ht*LHHLIL;%Wu0[L]A\EAD$DH]L@LÐAD$I$ADH=譻f.DSHHH4H9H[@AVAUATUHSH0H7dH%(HD$(1LNL9H?MI)I9LGL)LI9rIH9v/HD$(dH+%(QH0LHL[]A\A]A^IL9wɋFHJ4H(H9JT%HH9rpH)LHL)LHLLLD$I}LD$I]HHIMtLHD$(dH+%(H0L[]A\A]A^Lt$HLD$LLD$LHHLHD$ HH{H;=UItHU8t;CPSLLsHH)!DRCuH=L诺LHH5:H=HH|$ /HH LAH MLYMM)M9MGM9wLPLLH5H=S1蜔f.fAVIAUIATIUHHHHLLLHI]A\A]A^Nf.@H)H+71H H)H+7LAf.AUIATIHUHSHH.HLLH)I+$HIH[]A\A]fH)I)H+7f.@H)I)H+7f.@H)I)H+7nf.@H)I)H+7Nf.@H)H+71ATIUHHSHHt HKHtLH+H[]A\SHHH4H H[@SHHHHH[DHH9fHH9fH6HVpH6HV`HddH%(HD$1Ht$ t%BtD$HT$dH+%(uHH=_fEDHdH%(HD$1D$HcHL$st"sD$HT$dH+%(uHHt1H=f.AUIHATIUSHHHH9HHFHtLLu H)HHMH[]A\A]fATIUHSHHt H~L)HwuUfATHjIUHSH0HHvdH%(HD$(1H8t 0 wYHH_H\$HrHH$zHLH<$H9t1HD$(dH+%(u4H0[]A\HD$(dH+%(uH0HL[]A\MhHxf.fATHUHSH0dH%(HD$(1IH\$LH$LHH<$H9t聕HD$(dH+%(u H0[]A\H H?t&SHjCH[f.f.DATIUSHdH%(HD$HGHt"HT$dH+%(u}H?H[]A\DHl$fDA|$HH~,HHH)uD$HT$dH+%(u)H[]A\Du 8tH=27HdH%(HD$1H?tBx;1HT$RJx&D$x f* fHD$dH+%(uHBfHGHGHGATUSHHHnH;L&LHtMtqHw4HtHuEHk/[]A\@A$HkC/[]A\HH>u:H}HkHHHLH;Hk/[]A\H=軮H=路HATIUHHHSHH}tHtsHw4HtHuFH][]A\@A$H]E[]A\HH>uf.DATUSHHHnH;L&LHtMtqHw4HtHuEHk/[]A\@A$HkC/[]A\HH>u:H}讅HkHHHLH;Hk/[]A\H=bKH=GATILA\f.fLHI9tLHf.DHGHHHFH9t)HHVHWHVHHFHWFfDoFGDATISHHCHH6H?H9tpIL$HSH9tBI4$IL$IT$HSIT$Ht8H;HKHCLH[A\fI4$IT$HSIT$HHfDL9t;HSHtHt7HSI<$IT$H;뒐CHSI<$HyH7HwHHGHGHwHHw0HGH;ÐH?t@USHHHt$Hw6H?HHtHtE@H9HD$H;HCH[]fHt$1T6HHHD$HC@/HD$H;HCH[]fDd@HHHOHH9wVH=HH1ʅf.H?HH+wH9rPH"f.fHGH)H9HGf.HAH9w HGH9ADf.DIHtHuDLDDH)HtHuDf.H)HtHuDf.H)HtHuDSf.H)HtHuD#f.H)HHMf.AVAUATUSHdH%(HD$1H9t2L/LwLfHHM9HWL9rXMu3LcCD%HD$dH+%(H[]A\A]A^HuIt^LLKL+fDHHL$$q3H;II9t!H$L+HCMzafDAEL+Vd@UHHSHHHGII)t&Ht!HH?IHIt*LLHCHH)HCH[]fDHCDHGHGHGHGHGHGHGHf.HGHHHFH9t)HHVHWHVHHFHWFfDoFGDHGHNHHHFH9t%HHVHOHWHHFFfDoFHOHFGFfDLHI9tLHf.DATIBLA\f.fHHHHG@HHG@HHVHHf.@HHVHHf.@HHHfHHHfHHHG@HHVHHf.@HHHfHGHGH?ÐHGH9t HGfDfAWAVAUATUSHLcHH?I9tGHkHCHwQHEHtSkL#H[]A\A]A^A_fH9vIIL&|L;IMtLLHM9tLL+HkH[]A\A]A^A_f.HHsIHHSHLILLH)I)уK1҉уM L9r0C%DuSTATTfATHHHu 'X[]A\A]A^A_HHnf.@H3Hf.@HHGf.HH;wwHHHH HH=:eDH;wwHHHH H#H=%DHWH9sHHPH=T1]}f.HWH9sHHPH=$1-}f.HtHÐHH 9H>[H=b荶f.HtHÐHH HfH="Mf.HGHtHHDf.HH HqH=f.HGHtHHDf.HH YH|H=譵f.AUHWATIUSHH_HLkH9tIHWI9w @,I$Ml$DHL[]A\A]A11HL.I$DfAUHWATAUSHHHoHLmH9tHHWI9wD$(HLkD(H[]A\A]@A11HH+.HfDfATILA\f.fATISHHCHH6H?H9tpIL$HSH9tBI4$IL$IT$HSIT$Ht8H;HKHCLH[A\fI4$IT$HSIT$HHfDL9t;HSHtHtHSI<$IT$H;뒐CHSI<$HyHHOH9wOHHt6Hu H@H)H|$H9HFHD$Hf.HHw2HHH=F1H5eyUHSHHH+H@HEHH[]fUHSHHHH)HOH9t!H)HHH[H]fHoHH[H]f.fHHwHtHH@H H^H=IfH?AVAUIHATUSHOH)I9ILH?IH)ID$DHH9ID$H9rgJ2H)t%L9t LH4LHHI<$MtLIt[@L迿I<$I\$L[]A\A]A^fDLM1L*I<$MtDjfD@/I<$I<$MtyH=rHHwD1f.AHWH1EDHOH9w H1PHH=1H5 wf.fUDHSH1HH+H:HEHH[]f.fLOILH)L9IGL9w EPHLH5H=51~vf.@H)EH+7f.ATHWIDƹ1LA\f.UDHHSH1HH+H\HEHH[]f.@LOI9rv HHw0DHDL1L) f.f1DLNMI)I9LGHL9wHHW1hPLH51H=Luf.fIHWH1gf.IHWH1gf.LOILH)L9IGL9wgPHLH5H=y1tfATIHWIH1XgLA\ATIUHHHǾHUHLHI]1A\gf.fIHOH9w H1fPHH=1H5P-tf.HOLBL H9w L1fPHH=1H5 sfLALIHOHH)L9IGH9wLffPHH=Y1H5sf.AUIATIHUH趽IL$H9wLHL]IA\1A]fHH5hH=1pf.IHOH+7H9w H1bPHH=1H5of.ATISHHOH+7IH9wHH1XbHH[LA\HH=>1H5oHLQHLH MI)M9MGL9w"LOHLH)H9HGL9w!HaLH5KH=ָ1oHLH501H=o@HLRILH)H L9LFM9wLLOL9w&1HwaLLH51H=_nHLH51H=Dnf.DHVH6p HVH6` IHNH6HH)L9LFH9w HL5 PH5H=ַ1nf.DATIUHHH7HH?H+EH9wHLH]A\H=IH?H+GH9wPH=~H?H+GH9wtPH=NHATHHL`L9w3I)I9LGMtH0ItLLA\fLA\HLH5$1H=lf.H9taHHOHLFH9tTLOI9t{HHHFHGLNHFHWHGHVFHGHFHHGDI9tCHFoWVHHWLHGHFHGHVo^_HHHHFt-oGHtoNFHWOHFXf1HDofgHFHGHHFDHHHHNH6AUIATIHUH趵LHL]HA\A]HNH6鰬AUIATIHUHvLHL]HA\A]逬HOHHt HHH9HHF@84tHsf.HtcAVIAUATIUHSHLo DIHL4ֲHu!HI9w[H]A\A]A^H[]A\A]A^Hf.fHNH6pAUIATIHUHvLHL]HA\A]@@G2AUATUSHLgMtQHHtIIL/HI9LG fDIrCt%HHHtHL[]A\A]fDHI[L]A\A]HNH6pAUIATIHUH観LHL]HA\A]@@#AVAUATUSLoL9sKL7IHHHu&HL9t'A4HL'HuH[]A\A]A^fD[H]A\A]A^HNH6AUIATIHUHLHL]HA\A]PHHWH9s H HH9t@84tHAUATIUSHHGHt8HL/HHH9HFIHtCt%HH5HtIsHL[]A\A]f.fHNH6AUIATIHUHLHL]HA\A]PHOHHt(HHH9HHFfHr@84tUSHH_HnHH9HFHtH6H?褳u H)HHMH[]fUSHH_H9wVH)HiH9HGH9HHFHtH7HH12u H)HHMH[]HHH51H=1|ff.fUHHSHHXH9weHiI9wwH)H9HGL)L9IGHH9HFHtH1H8L荲u H)HHMH[]HHH51H=eHLH51H=qef.fAUIATIUSHH_HЯH9HHHFHtI<$Lu H)HHMH[]A\A]AVAUATIUSH_H9wfH)IHIH9HGPH9HHHFHtI}LL_u H)HHM[]A\A]A^HHH51H=\dUHHSHHXH9wRH)LH9HGLL9HFHtH8Hаu H)HHMH[]HHH5W1H=ϭdf.H7H7AULoATIUSHHHGGHBL/HpzIt$DŹ1LHSH3LHL[]A\A]HI<$I9t0lHxATH)UIHSHHdH%(HD$1H$HwNH?Hu5L$$H;LcB'HD$dH+%(uLH[]A\Ht!fH1HHH$HCLH}L$$H;f.DHGH0ATH)UIHSHHdH%(HD$1H$HwNH?Hu5L$$H;LcB'HD$dH+%(uLH[]A\Ht!fH1HHH$HCLH譯L$$H;f.DHGHVHLLL#ATIUHSHHdH%(HD$1Ht HI)L$$IwPH;Iu7EL$$H;LcB'HD$dH+%(u\H[]A\Mt$fHH1HHH$HCLH躮L$$H;H=zc HGHVHLLLHGHAUATIUHoSHHH/HVLLLHSH3LtHL[]A\A]II<$H9tiLYfLFHGHHL9wIH4LZPLH51H=`LFHGHHL9wI)H4I9LGJPLH5k1H=n_fHGHHf.HGHHf.HGHATHGIUHHHHt HvHTHHL]A\_f.DHH9fHH9fIȃ1w`(HH|HHtZDO(;O,}MHcHHG H@O(0HPL@@ÑwHu. uI4u1ÍF׃wH HcH>HHuHHtHtM[뮐O(;O,}8HcHHG H@O(Ht~H@HpP1ff.fHOHH[HuH[]H[f.lfHsH4kHsH_4H[]ÐHs>u˃\ff.ffD?/utHHu1HGff.AUIATIUSHHHBHjRHDH9wH@Ht8/tf1[]A\A]A^D5wLHLu݃tHsL|HuH[Hu@I HtDHKH@H@xHuxH@Hx8/tnfDAdž0Z1ff.fHGI8TudHPHWP_t[ntNHcxAIS:_u8HISAS(A;S,}&HcƒHIC H@AS(HHÐ1DHP1AUH5TATUHSH8dH%(HD$(1HHߠH臠HtrHL,(DHHHHDd DL9t=D#HuHƅHH@1HD$(dH+%(u H8[]A\A]I1~lIsIKHcH)H9|mHICACt8$tJ ~5H_GLOBAL_H9u&F$<;wHHr ~ Nt-DL(IC@HIC 1@ACH)AS(ACHA;S,}HcH WHIC AS(H@HH@ff.fATUSHW:SukHBHHGBuh1C@utHSCFH#tHD 8H8H9u@E1L[]A\DHBHGBPЀ wT<_tXH1Ҁ w5fD ҍL9wHStHBHC<_tCʍHЀ vэHw ҍL<_A19K8uHC0[]L$LA\DLB(C(s,Mt7DJ09HcȃHHK HAC(LADIHK@HJR SH9LcILc ID$C(A$IL$AT$HC8BHk@HHHC@LMHHIHC8BtHk@M|C8;C<pHS0HcȃL$ʉC8]HJRKE1z1)P[fDAWAVAUATUSHHHwdH%(HD$1HsDH H=HHt]aH HHHЋS(;S,}LcHILc ID$S(ID$@A$'CHHs DfDE1HD$dH+%( HL[]A\A]A^A_H1H IHtHCH߀8Ft_I$HtQwH $HPHHI$H$I$L$$MrC8;C<fHS0HcȃL$ʉC8S fH(H$IĐM'C8;C<HS0HcȃL$L$$C8HHHs1ɾ"HH^H$IDHHHs1ɾ$HH.H$IrfHHkH$IĀ}ISCPMoC8;C<cHS0HcȃL$1ɉC8EPwHHHkHLHH$IDF0HHHs1ɾ&HHH$If.HH$I@HHHs1ɾ#HH6H$Izf.HHHs1ɾ%HHH$IBfLFLCF<_|0< LfDHHHC0 v)HLIHLCA<_ IHLCL*HHfH$If.HHHsIHHHHL+HH$ITkLCLHbkL1ɾDHHH$IHMHC8@HPHS8E/C(;C,xLcILc ID$C(A$,FL$$0< fAD$wHHID$HHkHSt HBHCLcC(IHLc I$AD$ID$AD$C(;C,vLcILc ID$C(HA$'ID$CHC(;C,vLcILc ID$C(HrA$'ID$CH ~_PC(;C,fLcHILc ID$C(A$CHID$HC8_(HHHCL-HHH$IC(;C,vLcILc ID$C(HA$'ID$CH C(;C,uLcILc ID$C(H A$'ID$CHvC(;C,uLcILc ID$C(HFA$'ID$CH 3C(;C,euLcILc ID$C(HcA$'ID$CHC(;C,uLcILc ID$C(HA$'ID$CHH1ɾLHHH$ITC(;C,tLcILc ID$C(HA$'ID$CHDHHHs1ɾ(HHH$IfHH$IH8f.E1HHHC( LHH5IkLCLHkLIHsHEHD{(Ds8HCDkH HS:ItHkD{(Ds8DkHMDS8;S<8HK0HcL$S8HkLCLHHs kLIH蟓ff.@USHHOdH%(HD$1H$<.t:fD)щHcH IIFCHCH ȀCqDtE1@HE1}HzC(H{;C,LcILc ID$C(HI$AD$AL$It$JH뛹딹덹놉E1@HBHGJlSHHWHSI H'EHBHCB<_@HCNHfDHBHCRZ$E1S)HLDHIHC)fHIHC HHs1HWfLXHM<IUI HЀSfDH€Et-@t'Mt*AE8A;E<} IM0HcL$AE8vE1[L]A\A]A^ÐLhHMIEILHMIUIMtHBIEZHfMtHLIUHLLIUI HЀSCBLD.DATUHSOHAGHHGT0GHHPHWx6HPHWPT*Vr HU:LJLM:_DPE1A<$AA@@L(Dž0H$dH+%(:H[]A\A]A^A_DH(1HD$HL$H(H Ld$D$ HD$(H;H=D\$ E(HD$H(EfH ZH(IT$HHDxEuHH qX/A9W/HHuIT$H(Ld$D$ HD$HD$H(H HD$(X<|$ .HD$H(IT$D8IEu E14H(Hσ#J(A9A($5HD$H|$H(H Ld$D$ HD$(IT$Ht ;I|$ LIl.HA,L{4fLIHLDtDI9'D3IuƅHHAH@1fDIT$:H5HjMt$A>H.H$dH+%($:HLH[]A\A]A^A_:IT$:')HBX"'c1HH=0HHHHD(ƅ(C:HH=0HPHD)ƅ)A<$>0X0H$dH+%(8IT$HH[]A\A]A^A_9IT$9H$dH+%(?9IT$HH[]A\A]A^A_9fA|$,IT$HH9Bt7HV9HH=4HPHD ƅ fA|$?&H$dH+%(Y8HHH5[]A\A]A^A_hLl$0Ld$8L(H L(LLt$0HD$HLD$@MuU$fDHEu=oڃH)D0oHHL0ILH()L@@HHtHPvIT$H28DD$@L(E$CHHIIUHI 8Z$HHAtLs.HHHDlDI9!D+HH=uHƅHH@1HzHAtLs 1fDHHHDlDI9 D+HH=uHƅHH@1H܀HAcLs1fDHHHDlDL9 !D+HH=uHƅHH@1HSHAVLs1fDHHHDlDI9D+HH=uHƅHH@1HHAvLs 1fDHHHDlDI9D+HH=uHƅHH@1HH=)HPHD~ƅ~H$dH+%(z4IT$HH[]A\A]A^A_4H$dH+%(3IT$H[]A\A]A^A_4IT$HA Ls4H/@HHHDlDI9D+HH=uHƅHH@1Md$M!H$dH+%(P3HH5[]A\A]A^A_vH~HATLs/@HHHDlDI9D+HH=uHƅHH@1H~HATLs1fDHHHDlDI9D+HH=uHƅHH@1H}HAgLs1fDHHHDlDL9?D+HH=uHƅHH@1H|HAjLs1fDHHHDlDI9LD+HH=uHƅHH@1HZ|HAcLs1fDHHHDlDI9D+HH=uHƅHH@1H{HAvLs1fDHHHDlDI9D+HH=uHƅHH@1HD{HAnLs1fDHHHDlDI9D+HH=uHƅHH@1HzHAtLs1fDHHHDlDI9D+HH=uHƅHH@1IT$H(Ht[HD$HD$H(H Ld$HD$(D$ /HD$DT$ H(E H"HH="HPHD>ƅ>L(Hp8Mcl$I\$M%HI.HHHHDdDI9D#H=uHƅHH@1H0wHAhLs1fDHHHDlDI9nD+HH=uHƅHH@1HJwHAgLs1fDHHHDlDL9D+HH=uHƅHH@1ID$89IT$HBHxcd#LHtHvLH L^ID$82 (H@L5#vLH8P[ML$u IA8p(IQHYFMl$H5/IEL8L['LLZ(ID$HHP FID$82H@xH@8>H$dH+%()HH)[]A\A]A^A_鯴Ml$Md$AE214((~IUH))H`H$dH+%((HLH[]A\A]A^A_(EIT$i)HH=HPHD(ƅ(IT$H-)HH=HPHD)ƅ)hH$AT$1H57HWHHWH9HL,)fHHHHDdDI9D#HuHƅHH@1HA\$H=[HPH\H+sHAtLs.HHHDlDI9#D+HH=uHƅHH@1ID$8;H@8<LDLHHID$M|$H5rLhH@LpL`IGH8W%LHBLH;HLBH5JrHtH$dH+%(&HLH[]A\A]A^A_lB@HrHAjLs 1fDHHHDlDL9D+HH=uHƅHH@1HmqHAoLs1fDHHHDlDI9>D+HH=uHƅHH@1HpHAoLs1fDHHHDlDI9!D+HH=uHƅHH@1Ml$H_pHAoL{Mce0DHHHDtDI9 D3HH=uHƅHH@1IT$Md$Ht $HH=%HPHLHD{ƅ{]$HH=HPHD}ƅ}H$dH+%(c#IT$H[]A\A]A^A_7HboHAdLs 0DHHHDlDI9%D+HH=uHƅHH@1M|$E1L舯HuVfDE8/~HxsH@Et$HuH]nf.AE9}D<LH"E9~HH nA,(HHHHDDDH9tDH=uDD$HHH $ƅH@H $1DD$HkmHAnLs2HHHDlDL9 D+HH=uHƅHH@1IT$HkA[Ls!H2HHHHDlDI9D+H=uHƅHH@1I\$L(HLJ(HLl$0H 11I4LHIDz@ HXqHx5I H(IT$H ;u HD$H ES A_HLCtDHCI9/ HËCuHH=$HPHHSHD ƅ !HlHA{Ls5f.HHHDlDI9 D+HH=uHƅHH@1HpkHAgLs1fDHHHDlDI9 D+HH=uHƅHH@1HkHA{Ls 1fDHHHDlDI9D+HH=uHƅHH@1ID$LchHM%HI.HHHHDdDI9D#H=uHƅHH@1Mcl$I\$MHI0fHHHHDdDI9cD#H=uHƅHH@1IT$HHH= HPHD]ƅ]H$dH+%(zIT$HH[]A\A]A^A_EH$dH+%(EIT$HH[]A\A]A^A_ H$dH+%(IT$HH[]A\A]A^A_H$dH+%(IT$HH[]A\A]A^A_H$dH+%(=IT$HH[]A\A]A^A_]H$dH+%(IT$HH[]A\A]A^A_#H$dH+%(IT$HH[]A\A]A^A_H$dH+%({IT$HH[]A\A]A^A_IT$HHeLsA H*HHHHDlDI9t9D+H=uHƅHH@1H$dH+%(IT$HH[]A\A]A^A_H$dH+%(IT$HH[]A\A]A^A_H$dH+%(eIT$HH[]A\A]A^A_vH$dH+%( IT$HH[]A\A]A^A_<H$dH+%(IT$HH[]A\A]A^A_8IT$HHeA)Ls8H/HHHHDlDI9t9D+H=uHƅHH@1AT$H$H5_(1H߃HHGHHtoL,,fHHHHDdDI9t=D#HuHƅHH@1HHBHD}ƅ}H$dH+%(3IT$HH[]A\A]A^A_]IT$H$H5X'1H߃FHFHHdL,-fDHHHHDdDI91D#HuHƅHH@1HpHtH HD$HT$HT$H IT$: HsHpHD$H H$dH+%(IT$HH[]A\A]A^A_H$dH+%(IT$HH[]A\A]A^A_I] Q" Ml$B|# MEMHI0fHHHHDdDI9D#H=uHƅHH@1H$dH+%(IT$HH[]A\A]A^A_H$dH+%(IT$HH[]A\A]A^A_H$dH+%(mIT$HH[]A\A]A^A_IT$HH_LsA-oH-fDHHHHDlDI9t9D+H=uHƅHH@1H$dH+%(CIT$HH[]A\A]A^A_H$dH+%(IT$HH[]A\A]A^A_IT$LH$dH+%(;IT$HH[]A\A]A^A_LLH&IT$HH@H9@{L9nIL^H[HJH A1LDE/EAIQMIT$|$@HDž(H(LHq$L(ID$xA=H@<0<1H$dH+%(kHH5U^[]A\A]A^A_ifH$dH+%( HHH5][]A\A]A^A_)LHH8/ H HHH nH H5]H$ΝDH1H5N!@H@HHtcL,#HHHHDdDI9t:D#HuHƅHH@1HX HBHD}ƅ}IT$1H$H5 H߃9@H?HHL,*HHHHDdDI9D#HuHƅHH@11vHƅHH@1HƅHH@1HƅHH@1JHRHOHpt HD$H <* HH= HPHHD<ƅ HH=b HPHD>ƅ>IEHau{du{u A<$ A<$9 suv{Z7DCE)LHwHuHxtH@AHt8/tH$dH+%(NHHD[]A\A]A^A_鴜LH"guD{su>{u8H$dH+%( HLH[]A\A]A^A_s{t{(H.LHnH$dH+%( HH)[]A\A]A^A_s,{P"E1{tAMd$MA<$/ID$H8LuHpH1HuHxtH@Ht8/tAH= HPHD ƅ LH3"H5XE1eH$dH+%( HH[]A\A]A^A_ BD-LHHE1H@HDž`HƇH@1|HƅHH@1=HƅHH@1HƅHH@1HƇH@1H5UHH$kAFH5HߍP1:H;:IHtoHI*HHHHDdDI9t9D#H=uHƅHH@1H5xLʾHKHQHcH>H$dH+%(HHH5[]A\A]A^A_H$dH+%(bHHH59[]A\A]A^A_H$dH+%(0HHl[]A\A]A^A_ݒH$dH+%(HHu[]A\A]A^A_騒H$dH+%(HHH5p[]A\A]A^A_AHv c<H<H@ID$HHPzH5RHID$HHPUH$dH+%(HH)[]A\A]A^A_БXHPFHHDDHH9H;uHHHHu%fH9tL9tH@H H0H9uHHH$E1近H$HIA/m<L轏IHDHƅHH@1IQH$DH51H4Hm4IH[HI'HHHHDdDL9(D#H=uHƅHH@1맋<H迎HHHƅHH@1}ƅHHH@1LH H$dH+%(HHH5'Q[]A\A]A^A_AH[H HAHHH$H AH 規H$HIH ƅHHH@1s HNƅHHH@1 H襎ƅHHH@I]1"IT$:4IL$9)LD#IT$H@H$dH+%(hHLH[]A\A]A^A_H9\HcH HHPXHHPHHchDlHH1L`L_hIHMYLH?LHDA9+63HPzHR:>(HNID$H[7ID$HHPq]HLH?HP:)t Dž0HPHxH5lMH蒍I}tHL H螌LHM?H$dH+%(HLH[]A\A]A^A_MH(H-+ML$tH(uE11111111IT$1111|1w1r1m1h1c1^1Y1T1L"=18131.1)1$11111 11H$dH+%(u'HH5K[]A\A]A^A_00000000000000000|0w0UHSH(dH%(HD$1HtrBHӃg4YH$CHH4HHD$HHHHD$HHk4f.Dž0HD$dH+%(uH([]/f.AVAUATIUHSNwHuGHcH>L[H]A\A]A^HJHA Lk1fDHHHDdDL9D#HH=uHƅHH@1H[JHA Lk1fDHHHDdDI9D#HH=uHƅHH@1HIHA Lk1fDHHHHDdDI9D#H=uHƅHH@1HIHA Ls1fDHHHHDlDL9D+H=uHƅHH@1HHHBH Ƈ HHHBHD ƅ HH=%HPHD ƅ IT$O@IT$AfDHH=HPHD&ƅ&[]A\A]A^DHL%'H&Ml$,fDHHIH\M9tA$H=uHƅHH@1DHGHA Lk1fDHHHDdDI9/D#HH=uHƅHH@1HHH=zHPHD*ƅ*sHƅHH@IT$1 HƇH@1HƇH@1SƇHE H@fHƅHH@1HƅHH@1/HƇH@1ZHƇH@1]fDAUATIUHSHHHtXHȿHbIPu5HP +wHHHLHHuf.L(L1HHǃ(HHHBH(ƃ(HUHtH,HH=HPHHL)ƃ)NL(H[]A\A]@H aH=HPH1L(L(Hƃ(Hǃ(HH=8HPH)ƃ)HHƃH(ƃ(HUH@HǃHDЃ<( HH=HƃHH@1fHƃHH@1KH=|HPH Hƃ ufDHƃH)(ƃ(fHUH@HǃHƃHH H@AWAVAUATUSH8dH%(HD$(1HHHAI4V@IrDHKCL H )*tgHL HHt^0uTCuHSEuH5vHKCL H *uH HL DHD$(dH+%(H8[]A\A]A^A_H H}L L(HRHHDž(A:KL(L--;HM}(HHIHDtDM9t:EuH=uHƅHH@1HSLjAUHt>H4B5wHrLHL MmAUH_:A{L{ 'HHHDtDL9t=D3HH=uHƅHH@1AEHH5HߍP1HbIHMtaI#HHHHDtDL9t9D3H=uHƅHH@1Hj9A}L{'HHHHDtDI9t9D3H=uHƅHH@1MmAUDqAWHAVAUIATIUSHHHt&PHHu1LHHH= HPH ƃ HHBH[ƃ[IUHtHYHH=HPH]ƃ]H[]A\A]A^A_ÐH@8*L1ɾHaHHhHƃH[ƃ[IUH@HǃHAWDHƃHH@1&H-8HA L}-fDHHHHD4DL9t>DuH=uHƃHH@1@L1ɾH.HHtwHBH)ƃ)H=HƃH [ƃ[fIUH@HǃHƃHH)H@nfDAUATUHSH:2tH[]A\A]f.HBLchHXMtoHI&HHHHDdDL9t=D#H=uHƅHH@1@H[]A\A]DUHAWIAVAUATSHHHdH%(HE1?_H5T7L1]DžD1EIGHL0LI DžHLDž,Dž(HDž0HDž8Dž@DžH HcHIHHHH)H9tHH$H9uH)HtHLHH|$IHHHIH%HII)IL9tHH$L9uAL)MHH CMg A _Lu A ZL牍HHDžHL$HL1&nLIKMLAMtDDžDLHTzIHA?_uHAZHuIGHHAGdtHD[]A\A]A^A_fDANHȃHԼHHv FfDH{HGSHcHKHԼHLHvMu;HL[@{ؾ)WH։S؃hI9tLCHLCL[@HH8Ht(HԼHWPHw7W(xtCtRW(HfDuHO Hf.HHPH,/@HW HPHH/f.DHS@HfDH3@Hf.HfffdH%HHÐHfffdH%HHÐHHHt @Pu HHDHHpf.Dysmga[UOIC=71+%@HII@t u Ix81L'fDHtA<WH2HHAII4/AuH@H@tH9tA s$t>@:ttft H>HH:H|H| HzHH)H)HHe@1A@t AuIy8tOHÀ=IqHD$A@tAƀHD$I@8>:tt I@8A@t Au HI+Isff.S@AIIApA0~wA@uJH@PuI@HHHI[f^@`T1@PufDAPt9DII@HtAIDH@yHI[@AI@fDIcI@II@fDAI@L11ɐHIAIL ڄx?s@jIIL ]L11fHIAIL ڄx'H@AWAVAUATUSHHL$H91II׻L5{%H-$L-q~HwрB<H#HcH>fDLGHw ?HcHLDI9wHcHDH[]A\A]A^A_ow#O(ALA<&5HcDH>fD11DHLǃHH Ex?wA@t HHH pHcALMA@t Au MIfDwHWHL$LLD$HDI|HLtiV{QHcHcLDLL/H 7#HcH>f/v DBLuDI LtAHcLD#IcL>(HWHcH|qHH@E11HHЃHI x?@|HHI jf.E11HHЃHI x9fKSCHcHcHH|LLLDLLLDH|HCHLDfCHLDfHDCWHwHH9@H)LDuDLGHwbfDGHwRfLGHwBfDGHw2fLcGHw#DGHwSCHcHH|HLH|HHL11@HHЃHH DŽxsHcAD=MA@tA?<EMH11@>HHHH @xE11>HHHI @x?w@t HHI HcADMA@t Au <MMPHcADMA@ADHGH|GHw<$<lEQH_HgL1҉II&MM ȉMȉDɉIDɉIDɉIM1ȉM9ȉAEM9ȉAEM9ȉAEM9ȉAELHII|M)ȉrM!ȉhM9ȉAEVM9ȉAEDE)$)$)$ s $u H|$xII@I!HD$L4$tAƇHD$IG8@uaHD$H0'H}uHL\@H\$ $@t u MHD$L(_HD$11H8HHЃHH ƄxHT$@H1?IHtHD$ HD$@H\$MH-tHD$MLUML5"L|$(MfD{CIcL>fH;11fHHЃHH ƄxHT$HL}AELBtI$#f.HL}AEI$HHIII9NH\$Ht$L|$(HH?stHH?IH8[]A\A]A^A_DH;11ɐHHЃHH ƄxHT$HLH<$L|sYfHLH<$DAE:DHHc€uH<$HD@fDHt$ HD@$@H=rIqHD$8$@tƄ$HD$8HD$xKHǁ H9@UHE1HAWIAVL5AUIATSHH(LI?LHHL9sQLHу@t#tntI/IcL>fD?H`LHHHL9rHe[A\A]A^A_]@Ѓ??<wdHLDLȃ?E1҃?1DHL΃HI ExLX@wHHBLxLpL811ǃ@A1IHHH @xL4LHMLLEpHULEHHPH`HHHHPH`HHHHPH`HHHHM`LM Hǹ)HHH LzH )HHHL ILS11AIHЃHH ƄxHwHH3@L11fA1IHHH @xLL11D8HHHH @xE118HHHI @xHHH3BL |L11D8HHHH @xE118HHHI @x?w@LXHHH3BL 11AIHЃHH ƄxH011f.AIHЃHH Ƅx?w@t HHH ǃ@HXLH(eL11fD8HHHH @xE118HHHI @xLXH HIH3BL L11f8HHHH @xE118HHHI @xLXHHH3BL L11D8HHHH @xE118HHHI @x?w@tHHI t11DAIHЃHH ƄxHwHH3@L11fA1IHHH @xL11AIHЃHH ƄxIL~11fAIHЃHH Ƅx?@HHH L11f.0HHHH @xHHD;L110HHHH @xL11@0HHHH @xHHD;L118HHHH @xE118HHHI @x 11@AIHЃHH ƄxH(L11f.AIHЃHH ƄxH011f.AIHЃHH ƄxH(Lǃ@11AIHЃHH ƄxH0Lǃ@THHI )HH9tHH$H9uHPH$HHD$Hoff.AW01AVAUATIHUSHHIDŽ$IDŽ$I$HyI$HI$H?H|5HHI$LkHHHcCI)Mu L6A} eIDA}@dE110HHHI @xL`1E1I0HHHI @x?w@t HHI LX1E1@D0HHHI @xLhE1ƅqAz?ILBw<IcL>HqAIuMuIMLAEHLLIt`p<A<<{HڀrqE11:HHHI @xN,@HLLHt1H[]A\A]A^A_ÐA} hHMu HHxfD1fD0HHHI @xƅrAVIINIfDIANIHpAV^D0HPHL$LI@HT$LHPAVLƅsAI-@<sfDtH[]A\A]A^A_@I@HL$LIHD$I$bfHL$@LoHD$I$6DI$I$:HoHH9J[HHDž@HDž0HH)EH)HuHH(HH(H)H)HuHHHH0H)H)Hu HHHH8H)H)Hu0HppHHH@H)H)Hu@HphHHHHH)H)HuPHpxHHHPH)H)EHHHXH)E(HHH`HH)H)E8EHEXEhHu`DžDžDžDžDžDžDžDžH1HDžHDžhƅsuD fDt%H[]A\A]A^A_xuHcIxff.@AU1ATIUHSHHHLl$HLH$HH@H@H=\H5H=bwus=cLd$@tƅHD$LHDŽ$PHE8HDŽ$@HDŽ$8HHĘ[]A\A]D=bubzbtbnbhbbb\bVbPbJbDb>b8b2b,b&b bff.AWAVL5aAUAATUHSHHHT$Ld$DH$`Ht)DHUIHЃELHH$x1HH| t3HA H@t u HHILH-HE1AHH?H)H;EAF<E!HĘ[]A\A]A^A_fH|$L/}AWAVAUIATIUSHHGLwHT$H\$H$fH$MML ЅH$`Ht+I$ML AǃHLtH]LeLmLuL}LLHhH`H1HHt,HH=vHH-H=wHHHtHEHL HUH]LeLmLuL}HmHYUHAWAVHuLAULATILSRPHHUfoLfofofoHLfo fo0)fo@foP)fo`fop))fofo)foI|$) fo)0fo)@)P)`)p)])e)m)u"LLHhH`1HHt9HHv$f.HHHwHHHtHEHL HUH]LeLmLuL}HmHYWfUHAWAVAUATISRPHHuwH]LeLmLuL}HULHu<LLHLHHLLH*LLHhH`HHHt,HH=vHH-H=wHHHtHEHL HUH]LeLmLuL}HmHYHGHHtfff.@UHAWAVIAUIHuATLPSH`HHxHUdLHAօALHHE1HH Xt=sHH5S H`'@t 8u BHHLH\ADži`AHxD[A\A]A^A_]f.HJH9Nwf.AWLcIAVCL AUEATIUSHH4$D9|f~fDMtDL$ H3LIH$L$ЋL$LcL$ IIHO4HH$LI6Ѕy2IHL-IHA9~LcHciHID9|H[]A\A]A^A_fAWAVLrAUIATIUHSHHBHHD$AHxfDELLLsD|$AIcE~4HTHEA1LLHULHDHH[]A\A]A^A_ff.IIH@PtI< JHHcH>HHFHtpLDL@x I@HBHHHIDHIfHFHFHcHFHHFzH11fDHMAIL ExEfDH11ɐDHMAIL Ex?A@IIL ff.UHSH_ HHMHD} ztE1HD[]fDHxxfDHHxxf.HxxH] fHxxU Hl$Ru#FfDLtBuSHHRt%Pu8HPH1HRuDH[]DfHB8A!xHff.AWAVAUATUSH(.H<$HE1E11HD$JfD*<HD$LHtH4$HD$H9vHLH\++MHcCtLKEI)MI9tpL2A=A<p< <0utH$Lh@H$@ fffD9tH$H HL$HSALeAD<fDH(1[]A\A]A^A_MOMEhLHL$HSAD\$L $jDHL$1HƒUL $D\$fDHL$HS1L$'DHL$1HƒL,$1E1@LOgE1AR1cVQLff.AWHHAVAUATUSHHXR(HALt H/EH#HD$E1QfE1E1E1E1H AH)H1!DPtdtHDH8H9t<0uHpL LI9rHh(HI9LBLBMBH8H9uM/H/vAHDMt"H|$HtIT$(L%wDHW(ID$(LL@LXHH L0LhMMCA8L^HX[]A\A]A^A_f.HX[]A\A]A^A_@HQ H;?Hq(H?H%DH5CHHBHBHRH0H9uHCE1H&EHCC(HD$KfIHX1[]A\A]A^A_H95ICXLDCMML E1I$It$I9r @I9H NIT$(H@MII$It$I9rf.}M@@p 0HsLHL$Ut };LkLcH|$ HD$ Ht$HHD$@Ll$(Ld$0Ht$8HC HHHxHc@H)HUb0+Ml$@L{ME1Hl$@D$ HD$8HD$(HD$@H9wiM`M9s]O'HL$(|$LINtLD$IV7|$ 1HH&HD$8H|$LD$H9vMM9rf.E1HXL[]A\A]A^A_W H\$HHofHuHu!fDHuHHD$HSLHuID$ HID$bfHS1&H HLtIvH9t$HH9w8LkM#HD$*HD$@H9HEHD$L9l$HD$IlHLtIcFI~H)IVA<"p< /<0It$@HL$8DHL$@1HƒyHD$8HL$H9VIeHHD$HH\$H%H9؉¸EAD$ % AD$ HHD$I9$AD$ Il$>HuHfHT$LIHHuHHuD= shnuminvalid ELF shstrndx == 0-+ #0hlLhash_table_higher_prime_index../../gcc/hash-table.cELF section name out of range/usr/share/locale`utf-8utf8‘’COLUMNSGCC_EXTRA_DIAGNOSTIC_OUTPUTfixits-v1fixits-v2% failedMach-O segment name too longnot relocatable object fileopen temporary output fileclosing pipeline input fileopen temporary filepipeline already completeXXXXXXvforkdup2execvpexecv: error trying to exec '': TMPDIRTMPTEMP/tmpdecode_cmdline_option../../gcc/opts-common.c-Werror=kBKiBKBMBMiBGBGiBTBTiBPBPiBEBgenerate_canonical_optionmakeopen failed.gnu.debuglto_.debug_infoCOLLECT_GCCCOLLECT_GCC_OPTIONSCOLLECT_AS_OPTIONS '-Xassembler' -foffload-objects=@%li%n-flinker-output=rel.gnu.lto_-xlto-cMAKE--version/dev/null.execannot open %s: %m%u cannot read %s: %minvalid format of %s.gnu.offload_lto_OFFLOAD_TARGET_NAMESCOMPILER_PATHLIBRARY_PATH/crtoffloadtable.o.crtoffloadtable.orbreading input filewriting output file.lto.o-o.ltrans.out-fltrans-output-list=Using make jobserver -fwpa=jobserver-fwpa=%ld-fwpa=%i-fwpa%s: %s.debug.temp.o%: %s: %m%i .mk%sltrans%u.ltrans-fltrans%s: @%s '%s'ltrans%u.ltrans_args.PHONY: all all: \ %sMAKEFLAGS=MFLAGS=-f-j%ld-fno-diagnostics-show-caret-fdiagnostics-color=never-fdiagnostics-urls=never--param-fdiagnostics-plain-outputprune_options'\''""@[cannot find %s]cannot find %qscollect2-fPIE-fno-pie-fpie-fcf-protectionmerge_and_complain../../gcc/lto-wrapper.c-O%d--jobserver-auth=fifo:MAKEFLAGS%d,%dcannot access %<%> file descriptorsjobserver is not available: preinitunlimitedvery-cheapglobal-dynamicinitial-execlocal-dynamiclocal-execgnu2internalprotectedsomebyte_looplibcallrep_4byterep_8byterep_byteunrolled_loopvector_looplibc++named_varsbig-endianlittle-endiannativesimplestcprefer-atomicsinglemultithreadedparallel-runsserial256512ts-18661-3guideddecomposeparloopsilp32lp641to1balancedmaxdynnolto-relunknowninline-cloneinline-only-staticacmlsvmlcachelinepackagepublicmixedCBprioritynop5keepthunkthunk-externthunk-inlineindirect-jmp-infsnanswap387+sse387,ssebothsse+387sse,387standardlegacy-firstrangerranger-debugranger-firstranger-traceminimaldisplayevery-lineonceinline-eventsseparate-eventsnfcnfkcanyunpairedzlibzlib-gnukernellargemediumsmallfullsysvsafeonlyattintelunknown evrp mode %qsValid arguments to -mfpmath=:Unrecognized option: %qsunknown IRA algorithm %qsunknown IRA region %qsunknown linker output %qsunknown offload ABI %qsunknown Stack Reuse Level %qsunknown TLS model %qs-###--all-warnings--ansi--assemble--assertassertion missing after %qs--assert=--comments--comments-in-macros--compile--completion=--coverage--debug--define-macromacro name missing after %qs--define-macro=--dependencies--dump--dump=--dumpbase--dumpbase-ext--dumpdir--entry--entry=--extra-warnings--for-assembler--for-assembler=--for-linker--for-linker=--force-link--force-link=--helpDisplay this information.--help=--imacrosmissing filename after %qs--imacros=--include--include-barrier--include-directorymissing path after %qs--include-directory-after--include-directory-after=--include-directory=--include-prefix--include-prefix=--include-with-prefix--include-with-prefix-after--include-with-prefix-after=--include-with-prefix-before--include-with-prefix-before=--include-with-prefix=--include=--language--language=--library-directory--library-directory=--no-canonical-prefixes--no-integrated-cpp--no-line-commands--no-standard-includes--no-standard-libraries--no-sysroot-suffix--no-warnings--optimize--output--output-pch=--output=--param=align-threshold=--param=asan-globals=--param=asan-memintrin=--param=asan-stack=Enable asan stack protection.--param=avg-loop-niter=--param=avoid-fma-max-bits=--param=dse-max-object-size=--param=early-inlining-insns=--param=evrp-mode=--param=fsm-scale-path-stmts=--param=ggc-min-expand=--param=ggc-min-heapsize=--param=inline-min-speedup=--param=inline-unit-growth=--param=integer-share-limit=--param=ipa-cp-unit-growth=--param=ipa-max-aa-steps=--param=ipa-max-agg-items=--param=ira-max-loops-num=--param=l1-cache-line-size=The size of L1 cache line.--param=l1-cache-size=The size of L1 cache.--param=l2-cache-size=The size of L2 cache.--param=large-function-insns=--param=large-stack-frame=--param=large-unit-insns=--param=lazy-modules=--param=lim-expensive=--param=loop-block-tile-size=--param=lto-max-partition=--param=lto-min-partition=--param=lto-partitions=--param=max-combine-insns=--param=max-crossjump-edges=--param=max-cse-insns=--param=max-cse-path-length=--param=max-fsm-thread-paths=--param=max-gcse-memory=--param=max-hoist-depth=--param=max-isl-operations=--param=max-last-value-rtl=--param=max-peel-branches=--param=max-peel-times=--param=max-peeled-insns=--param=max-pow-sqrt-depth=--param=max-slsr-cand-scan=--param=max-stores-to-merge=--param=max-stores-to-sink=--param=max-stores-to-track=--param=max-tracked-strlens=--param=max-unroll-times=--param=max-unrolled-insns=--param=max-unswitch-insns=--param=max-unswitch-level=--param=max-vartrack-size=--param=min-crossjump-insns=--param=min-pagesize=--param=min-spec-prob=--param=min-vect-loop-bound=--param=modref-max-accesses=--param=modref-max-bases=--param=modref-max-depth=--param=modref-max-refs=--param=modref-max-tests=--param=openacc-kernels=--param=parloops-chunk-size=--param=parloops-schedule=--param=prefetch-latency=--param=ranger-logical-depth=--param=scev-max-expr-size=--param=sms-dfa-history=--param=sms-max-ii-factor=--param=sms-min-sc=--param=sra-max-propagations=--param=ssp-buffer-size=--param=tree-reassoc-width=--param=uninlined-thunk-time=--param=use-canonical-types=--pass-exit-codes--pedantic--pedantic-errors--pie--pipe--prefix--prefix=--preprocess--print-file-name--print-file-name=--print-libgcc-file-name--print-multi-directory--print-multi-lib--print-multi-os-directory--print-multiarch--print-prog-name--print-prog-name=--print-search-dirs--print-sysroot--profile--save-temps--shared--specs--specs=--static--static-pie--symbolic--sysroot--sysroot=--target-helpAlias for --help=target.--time--trace-includes--traditional--traditional-cpp--trigraphs--undefine-macro--undefine-macro=--user-dependencies--verbose--write-dependencies--write-user-dependencies-A-B-CDo not discard comments.-CC-D-E-F-H-Hd-Hf-I-J-L-MGenerate make dependencies.-MD-MF-MG-MM-MMD-MP-MQ-MT-Mmodules-Mno-modules-N-O-Ofast-Og-Os-P-Q-Qn-Qy-R-S-T-Tbss-Tbss=-Tdata-Tdata=-Ttext-Ttext=-U-U Undefine .-W-WNSObject-attribute-Wa,-Wabi-Wabi-tag-Wabi=-Wabsolute-value-Waddress-Waddress-of-packed-member-Waggregate-return-Waliasing-Walign-commons-Waligned-new-Waligned-new=-WallEnable most warning messages.-Walloc-size-larger-than=-Walloc-zero-WallocaWarn on any use of alloca.-Walloca-larger-than=-Wampersand-Wanalyzer-double-fclose-Wanalyzer-double-free-Wanalyzer-file-leak-Wanalyzer-free-of-non-heap-Wanalyzer-malloc-leak-Wanalyzer-null-argument-Wanalyzer-null-dereference-Wanalyzer-too-complex-Wanalyzer-use-after-free-Wanalyzer-write-to-const-Wargument-mismatch-Warith-conversion-Warray-bounds-Warray-bounds=-Warray-parameter-Warray-parameter=-Warray-temporaries-Wassign-intercept-Wattribute-alias-Wattribute-alias=-Wattribute-warning-Wattributes-Wbad-function-cast-Wbidi-chars-Wbidi-chars=-Wbool-compare-Wbool-operation-Wbuiltin-macro-redefined-Wc++-compat-Wc++0x-compat-Wc++11-compat-Wc++14-compat-Wc++17-compat-Wc++1z-compat-Wc++20-compat-Wc++2a-compat-Wc-binding-type-Wc11-c2x-compat-Wc90-c99-compat-Wc99-c11-compat-Wcannot-profile-Wcast-align-Wcast-align=strict-Wcast-function-type-Wcast-qual-Wcast-result-Wcatch-value-Wcatch-value=-Wchar-subscripts-Wcharacter-truncation-Wchkp-Wclass-conversion-Wclass-memaccess-Wclobbered-Wcomma-subscript-Wcomment-WcommentsSynonym for -Wcomment.-Wcompare-reals-Wconditionally-supported-Wconversion-Wconversion-extra-Wconversion-null-Wcoverage-mismatch-Wcpp-Wctad-maybe-unsupported-Wctor-dtor-privacy-Wdangling-elseWarn about dangling else.-Wdate-time-Wdeclaration-after-statement-Wdelete-incomplete-Wdelete-non-virtual-dtor-Wdeprecated-Wdeprecated-copy-Wdeprecated-copy-dtor-Wdeprecated-declarations-Wdesignated-init-Wdisabled-optimization-Wdiscarded-array-qualifiers-Wdiscarded-qualifiers-Wdiv-by-zero-Wdo-subscript-Wdouble-promotion-Wduplicate-decl-specifier-Wduplicated-branches-Wduplicated-cond-Weffc++-Wempty-body-Wendif-labels-Wenum-compare-Wenum-conversion-WerrorTreat all warnings as errors.implicit-function-declaration-Wexceptions-Wexpansion-to-defined-Wextra-Wextra-semi-Wfatal-errors-Wfloat-conversion-Wfloat-equal-Wformat-Wformat-contains-nul-Wformat-diag-Wformat-extra-args-Wformat-nonliteral-Wformat-overflow-Wformat-overflow=-Wformat-security-Wformat-signedness-Wformat-truncation-Wformat-truncation=-Wformat-y2k-Wformat-zero-length-Wformat=-Wframe-address-Wframe-larger-than=-Wfree-nonheap-object-Wfrontend-loop-interchange-Wfunction-elimination-Whsa-Wif-not-aligned-Wignored-attributes-Wignored-qualifiers-Wimplicit-Wimplicit-fallthrough-Wimplicit-fallthrough=-Wimplicit-int-Wimplicit-interface-Wimplicit-procedure-Wimport-Winaccessible-base-Wincompatible-pointer-types-Winherited-variadic-ctor-Winit-list-lifetime-Winit-self-Winline-Wint-conversion-Wint-in-bool-context-Wint-to-pointer-cast-Winteger-division-Wintrinsic-shadow-Wintrinsics-std-Winvalid-imported-macros-Winvalid-memory-model-Winvalid-offsetof-Winvalid-pch-Wjump-misses-init-Wl,-Wlarger-than--Wlarger-than=-Wline-truncation-Wliteral-suffix-Wlogical-not-parentheses-Wlogical-op-Wlong-long-Wlto-type-mismatch-Wmain-Wmaybe-uninitialized-Wmemset-elt-size-Wmemset-transposed-args-Wmisleading-indentation-Wmismatched-dealloc-Wmismatched-new-delete-Wmismatched-tags-Wmissing-attributes-Wmissing-braces-Wmissing-declarations-Wmissing-field-initializers-Wmissing-format-attribute-Wmissing-include-dirs-Wmissing-index-Wmissing-noreturn-Wmissing-parameter-type-Wmissing-profile-Wmissing-prototypes-Wmudflap-Wmultichar-Wmultiple-inheritance-Wmultistatement-macros-WnamespacesWarn on namespace definition.-Wnarrowing-Wnested-externs-Wno-alloc-size-larger-than18446744073709551615EiB-Wno-alloca-larger-than-Wno-frame-larger-than-Wno-larger-than-Wno-stack-usage-Wno-vla-larger-than-Wnoexcept-Wnoexcept-type-Wnon-template-friend-Wnon-virtual-dtor-Wnonnull-Wnonnull-compare-Wnormalized-Wnormalized=-Wnull-dereference-Wobjc-root-class-Wodr-Wold-style-cast-Wold-style-declaration-Wold-style-definition-Wopenmp-simd-Woverflow-Woverlength-strings-Woverloaded-virtual-Woverride-init-Woverride-init-side-effects-Woverwrite-recursive-Wp,-Wpacked-Wpacked-bitfield-compat-Wpacked-not-aligned-Wpadded-Wparentheses-Wpedantic-Wpessimizing-move-Wplacement-new-Wplacement-new=-Wpmf-conversions-Wpointer-arith-Wpointer-compare-Wpointer-sign-Wpointer-to-int-cast-Wpragmas-Wprio-ctor-dtor-Wproperty-assign-default-Wprotocol-Wpsabi-Wrange-loop-construct-Wreal-q-constant-Wrealloc-lhs-Wrealloc-lhs-all-Wredundant-decls-Wredundant-move-Wredundant-tags-Wregister-Wreorder-Wrestrict-Wreturn-local-addr-Wreturn-type-Wscalar-storage-order-Wselector-Wsequence-point-Wshadow-Wshadow-compatible-local-Wshadow-ivar-Wshadow-local-Wshadow=compatible-local-Wshadow=global-Wshadow=local-Wshift-count-negative-Wshift-count-overflow-Wshift-negative-value-Wshift-overflow-Wshift-overflow=-Wsign-compare-Wsign-conversion-Wsign-promo-Wsized-deallocation-Wsizeof-array-argument-Wsizeof-array-div-Wsizeof-pointer-div-Wsizeof-pointer-memaccess-Wspeculative-Wstack-protector-Wstack-usage=-Wstrict-aliasing-Wstrict-aliasing=-Wstrict-null-sentinel-Wstrict-overflow-Wstrict-overflow=-Wstrict-prototypes-Wstrict-selector-match-Wstring-compare-Wstringop-overflow-Wstringop-overflow=-Wstringop-overread-Wstringop-truncation-Wsubobject-linkage-Wsuggest-attribute=cold-Wsuggest-attribute=const-Wsuggest-attribute=format-Wsuggest-attribute=malloc-Wsuggest-attribute=noreturn-Wsuggest-attribute=pure-Wsuggest-final-methods-Wsuggest-final-types-Wsuggest-override-Wsurprising-Wswitch-Wswitch-bool-Wswitch-default-Wswitch-enum-Wswitch-outside-range-Wswitch-unreachable-Wsync-nand-Wsynth-Wsystem-headers-Wtabs-Wtarget-lifetime-Wtautological-compare-Wtemplates-Wterminate-Wtraditional-Wtraditional-conversion-Wtrampolines-Wtrigraphs-Wtsan-Wtype-limits-Wundeclared-selector-Wundef-Wundefined-do-loop-Wunderflow-Wuninitialized-Wunknown-pragmas-Wunreachable-code-Wunsafe-loop-optimizations-Wunsuffixed-float-constants-Wunused-Wunused-but-set-parameter-Wunused-but-set-variable-Wunused-const-variable-Wunused-const-variable=-Wunused-dummy-argument-Wunused-function-Wunused-labelWarn when a label is unused.-Wunused-local-typedefs-Wunused-macros-Wunused-parameter-Wunused-result-Wunused-value-Wunused-variable-Wuse-without-only-Wuseless-castWarn about useless casts.-Wvarargs-Wvariadic-macros-Wvexing-parse-Wvirtual-inheritance-Wvirtual-move-assign-Wvla-Wvla-larger-than=-Wvla-parameter-Wvolatile-Wvolatile-register-var-Wwrite-strings-Wzero-length-bounds-Wzerotrip-XGenerate JSON file.-Xassembler-Xf-Xlinker-Xpreprocessor-Z-aux-info-aux-info=Dump the symtab callgraph.Enable preprocessing.-cpp=-d-debuglib=-defaultlib=-defined-only-demangleDump the demangled output.-dstartfiles-dump-body=-dump-level=-dumpfullversion-dumpmachine-dumpspecs-dumpversion-e-export-dynamic-fPIC-fRTS=Select the runtime.-fabi-compat-version=-fabi-version=-faccess-control-fada-spec-parent=-falign-commons-falign-functionsAlign the start of functions.-falign-functions=-falign-jumps-falign-jumps=-falign-labelsAlign all labels.-falign-labels=-falign-loopsAlign the start of loops.-falign-loops=-faligned-new-faligned-new=-fall-instantiations-fall-intrinsics-fall-virtual-fallocation-dce-fallow-argument-mismatch-fallow-invalid-boz-fallow-leading-underscore-fallow-store-data-races-falt-external-templatesNo longer supported.-fanalyzerEnable static analysis pass.-fanalyzer-call-summaries-fanalyzer-checker=-fanalyzer-feasibility-fanalyzer-fine-grained-fanalyzer-state-merge-fanalyzer-state-purge-fanalyzer-transitivity-fanalyzer-verbose-edges-fanalyzer-verbosity=-fargument-alias-fargument-noalias-fargument-noalias-anything-fargument-noalias-global-fasan-shadow-offset=-fasmRecognize the "asm" keyword.-fassert-fassociative-math-fassume-phsa-fasynchronous-unwind-tables-fauto-inc-dec-fauto-profile-fauto-profile=-fautomatic-fbackslash-fbacktrace-fbit-tests-fblas-matmul-limit=-fbounds-check-fbounds-check=-fbranch-count-reg-fbranch-probabilities-fbranch-target-load-optimize-fbtr-bb-exclusive-fbuilding-libgcc-fbuilding-libphobos-tests-fbuiltinRecognize built-in functions.-fbuiltin--fbuiltin-printfIgnored.-fc-prototypes-fc-prototypes-external-fcall-saved--fcall-used--fcaller-saves-fcallgraph-info-fcallgraph-info=-fcanonical-system-headers-fcf-protection=-fchar8_t-fcheck-array-temporaries-fcheck-data-deps-fcheck-new-fcheck-pointer-bounds-fcheck=-fchecking-fchecking=-fchkp-check-incomplete-type-fchkp-check-read-fchkp-check-write-fchkp-instrument-calls-fchkp-instrument-marked-only-fchkp-narrow-bounds-fchkp-optimize-fchkp-store-bounds-fchkp-use-static-bounds-fchkp-use-wrappers-fcilkplus-fcoarray=-fcode-hoistingEnable code hoisting.-fcombine-stack-adjustments-fcommon-fcompare-debug-fcompare-debug-second-fcompare-debug=-fcompare-elim-fconcepts-fconcepts-diagnostics-depth=-fconcepts-ts-fcond-mismatch-fconserve-space-fconserve-stack-fconstant-string-class=-fconstexpr-cache-depth=-fconstexpr-depth=-fconstexpr-loop-limit=-fconstexpr-ops-limit=-fconvert=-fcoroutines-fcprop-registers-fcray-pointer-fcrossjumping-fcse-follow-jumps-fcse-skip-blocks-fcx-fortran-rules-fcx-limited-range-fd-lines-as-code-fd-lines-as-comments-fdata-sections-fdbg-cnt-list-fdbg-cnt=-fdce-fdebugCompile in debug code.-fdebug-aux-vars-fdebug-cpp-fdebug-prefix-map=-fdebug-types-section-fdebug=-fdec-fdec-add-missing-indexes-fdec-blank-format-item-fdec-char-conversions-fdec-duplicates-fdec-format-defaults-fdec-include-fdec-intrinsic-ints-fdec-math-fdec-non-integer-index-fdec-non-logical-if-fdec-old-init-fdec-override-kind-fdec-promotion-fdec-sequence-fdec-static-fdec-structure-fdeclone-ctor-dtor-fdeduce-init-list-fdefault-double-8-fdefault-inline-fdefault-integer-8-fdefault-real-10-fdefault-real-16-fdefault-real-8-fdefer-pop-fdelayed-branch-fdelete-dead-exceptions-fdelete-null-pointer-checks-fdevirtualize-fdevirtualize-at-ltrans-fdevirtualize-speculatively-fdiagnostics-color-fdiagnostics-color=-fdiagnostics-column-origin=-fdiagnostics-column-unit=-fdiagnostics-format=-fdiagnostics-generate-patch-fdiagnostics-path-format=-fdiagnostics-show-caret-fdiagnostics-show-cwe-fdiagnostics-show-labels-fdiagnostics-show-location=-fdiagnostics-show-option-fdiagnostics-urls=-fdirectives-onlyPreprocess directives only.-fdisable--fdocGenerate documentation.-fdoc-dir=-fdoc-file=-fdoc-inc=-fdollar-ok-fdollars-in-identifiers-fdruntime-fdse-fdump--fdump-ada-spec-fdump-ada-spec-slim-fdump-analyzer-fdump-analyzer-callgraph-fdump-analyzer-feasibility-fdump-analyzer-json-fdump-analyzer-state-purge-fdump-analyzer-stderr-fdump-analyzer-supergraph-fdump-core-fdump-d-original-fdump-final-insns-fdump-final-insns=-fdump-fortran-global-fdump-fortran-optimized-fdump-fortran-original-fdump-go-spec=-fdump-internal-locations-fdump-noaddr-fdump-parse-tree-fdump-passesDump optimization passes.-fdump-scos-fdump-unnumbered-fdump-unnumbered-links-fdwarf2-cfi-asm-fearly-inliningPerform early inlining.-felide-constructors-felide-type-feliminate-dwarf2-dups-femit-class-debug-always-femit-struct-debug-baseonly-femit-struct-debug-detailed=-femit-struct-debug-reduced-fenable--fenforce-eh-specs-fenum-int-equiv-fexceptionsEnable exception handling.-fexcess-precision=-fexec-charset=-fexpensive-optimizations-fext-numeric-literals-fextended-identifiers-fextern-tls-init-fexternal-blas-fexternal-templates-ff2cUse f2c calling convention.-ffast-math-ffat-lto-objects-ffile-prefix-map=-ffinite-loops-ffinite-math-only-ffixed--ffixed-form-ffixed-line-length--ffixed-line-length-none-ffloat-store-ffor-scope-fforce-addr-fforward-propagate-ffp-contract=-ffp-int-builtin-inexact-ffpe-summary=-ffpe-trap=-ffree-form-ffree-line-length--ffree-line-length-none-ffreestanding-ffriend-injection-ffrontend-loop-interchange-ffrontend-optimize-ffunction-cse-ffunction-sections-fgcse-fgcse-after-reload-fgcse-las-fgcse-lm-fgcse-sm-fgimpleEnable parsing GIMPLE.-fgnat-encodings=-fgnu-keywords-fgnu-runtime-fgnu-tm-fgnu-unique-fgnu89-inline-fgo-c-header=-fgo-check-divide-overflow-fgo-check-divide-zero-fgo-compiling-runtime-fgo-debug-escape-fgo-debug-escape-hash=-fgo-debug-optimization-fgo-dump--fgo-embedcfg=-fgo-optimize--fgo-pkgpath=-fgo-prefix=-fgo-relative-import-path=-fgraphite-fgraphite-identity-fguess-branch-probability-fguiding-decls-fhandle-exceptions-fhelp-fhelp=-fhoist-adjacent-loads-fhonor-std-fhosted-fhuge-objects-fidentProcess #ident directives.-fif-conversion-fif-conversion2-fignore-unknown-pragmasIgnore unsupported pragmas.-fimplement-inlines-fimplicit-inline-templates-fimplicit-none-fimplicit-templates-findirect-inliningPerform indirect inlining.-finhibit-size-directive-finit-character=-finit-derived-finit-integer=-finit-local-zero-finit-logical=-finit-real=-finline-finline-arg-packing-finline-atomics-finline-functions-finline-limit--finline-limit=-finline-matmul-limit=-finline-small-functions-finput-charset=-finstrument-functions-finteger-4-integer-8-fintrinsic-modules-path-fintrinsic-modules-path=-finvariants-fipa-bit-cp-fipa-cp-fipa-cp-alignment-fipa-cp-clone-fipa-icf-fipa-icf-functions-fipa-icf-variables-fipa-matrix-reorg-fipa-modref-fipa-profile-fipa-pta-fipa-pure-const-fipa-ra-fipa-reference-fipa-reference-addressable-fipa-sra-fipa-stack-alignment-fipa-struct-reorg-fipa-vrp-fira-algorithm=-fira-hoist-pressure-fira-loop-pressure-fira-region=-fira-share-save-slots-fira-share-spill-slots-fira-verbose=-fivar-visibility=-fivopts-fjump-tables-fkeep-gc-roots-live-fkeep-inline-dllexport-fkeep-inline-functions-fkeep-static-consts-fkeep-static-functions-flabels-ok-flang-info-include-translatemissing header name-flang-info-module-cmi-flang-info-module-cmi=missing module name-flarge-source-files-flax-vector-conversions-fleading-underscore-flifetime-dse-flifetime-dse=-flimit-function-alignment-flinker-output=-flive-patching-flive-patching=-flive-range-shrinkage-flocal-ivars-flogical-as-integer-floop-block-floop-flatten-floop-interchange-floop-nest-optimize-floop-optimize-floop-parallelize-allMark all loops as parallel.-floop-strip-mine-floop-unroll-and-jam-flra-remat-flto-flto-compression-level=-flto-odr-type-merging-flto-partition=-flto-report-flto-report-wpa-flto=-fmacro-prefix-map=-fmain-fmath-errno-fmax-array-constructor=-fmax-errors=-fmax-identifier-length=-fmax-include-depth=-fmax-stack-var-size=-fmax-subrecord-length=-fmem-report-fmem-report-wpa-fmerge-all-constants-fmerge-constants-fmerge-debug-strings-fmessage-length=-fmodule-file=-fmodule-header-fmodule-header=-fmodule-implicit-inline-fmodule-lazyEnable lazy module importing.-fmodule-mapper=missing mapper-fmodule-only-fmodule-private-fmodule-version-ignore-fmoduleinfo-fmodules-ts-fmodulo-sched-fmodulo-sched-allow-regmoves-fmove-loop-invariants-fms-extensions-fmudflap-fmudflapir-fmudflapth-fname-mangling-version--fnew-abi-fnew-inheriting-ctors-fnew-ttp-matching-fnext-runtime-fnil-receivers-fno-modules-fnon-call-exceptions-fnonansi-builtins-fnonnull-objects-fnothrow-opt-fobjc-abi-version=-fobjc-call-cxx-cdtors-fobjc-direct-dispatch-fobjc-exceptions-fobjc-gc-fobjc-nilcheck-fobjc-sjlj-exceptions-fobjc-std=objc1-foffload-abi=-foffload=-fomit-frame-pointer-fonly=-fopenaccEnable OpenACC.-fopenacc-dim=-fopenmp-fopenmp-simd-foperator-names-fopt-info-fopt-info--foptimize-register-move-foptimize-sibling-calls-foptimize-strlen-foptional-diags-fpack-derived-fpack-struct-fpack-struct=-fpad-source-fpartial-inliningPerform partial inlining.-fpatchable-function-entry=-fpcc-struct-return-fpch-deps-fpch-preprocess-fpeel-loopsPerform loop peeling.-fpeephole-fpeephole2-fpermissive-fpermitted-flt-eval-methods=-fpic-fplan9-extensions-fplt-fplugin-arg--fplugin=Specify a plugin to load.-fpost-ipa-mem-report-fpostconditions-fpre-include=-fpre-ipa-mem-report-fpreconditions-fpredictive-commoning-fprefetch-loop-arrays-fpreprocessed-fpretty-templates-fprintf-return-value-fprofile-fprofile-abs-path-fprofile-arcs-fprofile-correction-fprofile-dir=-fprofile-exclude-files=-fprofile-filter-files=-fprofile-generate-fprofile-generate=-fprofile-info-section-fprofile-info-section=-fprofile-note=-fprofile-partial-training-fprofile-prefix-path=-fprofile-reorder-functions-fprofile-report-fprofile-reproducible=-fprofile-update=-fprofile-use-fprofile-use=-fprofile-values-fprotect-parens-frandom-seed-frandom-seed=-frange-check-freal-4-real-10-freal-4-real-16-freal-4-real-8-freal-8-real-10-freal-8-real-16-freal-8-real-4-frealloc-lhs-freciprocal-math-frecord-gcc-switches-frecord-marker=4-frecord-marker=8-frecursive-freg-struct-return-fregmove-freleaseCompile release version.-frename-registers-freorder-blocks-freorder-blocks-algorithm=-freorder-functions-frepack-arrays-freplace-objc-classes-frepo-freport-bug-frequire-return-statement-frerun-cse-after-loop-frerun-loop-opt-fresolution=The resolution file.-frounding-math-frtti-fsanitize-coverage=-fsanitize-recover-fsanitize-recover=-fsanitize-sections=-fsanitize=Select what to sanitize.-fsave-optimization-record-fsched-dep-count-heuristic-fsched-group-heuristic-fsched-interblock-fsched-last-insn-heuristic-fsched-pressure-fsched-rank-heuristic-fsched-spec-fsched-spec-insn-heuristic-fsched-spec-load-fsched-spec-load-dangerous-fsched-stalled-insns-fsched-stalled-insns-dep-fsched-stalled-insns-dep=-fsched-stalled-insns=-fsched-verbose=-fsched2-use-superblocks-fsched2-use-traces-fschedule-fusion-fschedule-insns-fschedule-insns2-fsecond-underscore-fsection-anchors-fsee-fsel-sched-pipelining-fselective-scheduling-fselective-scheduling2-fself-test=-fsemantic-interposition-fshort-enums-fshort-wchar-fshow-column-fshrink-wrap-fshrink-wrap-separate-fsign-zero-fsignaling-nans-fsigned-bitfields-fsigned-char-fsigned-zeros-fsimd-cost-model=-fsingle-precision-constant-fsized-deallocation-fsplit-ivs-in-unroller-fsplit-loopsPerform loop splitting.-fsplit-paths-fsplit-stack-fsplit-wide-types-fsplit-wide-types-early-fsquangle-fssa-backprop-fssa-phiopt-fsso-struct=-fstack-arrays-fstack-checkspecific-fstack-check=-fstack-clash-protection-fstack-limit-fstack-limit-register=-fstack-limit-symbol=-fstack-protector-fstack-protector-all-fstack-protector-explicit-fstack-protector-strong-fstack-reuse=-fstack-usage-fstats-fstdarg-opt-fstore-mergingMerge adjacent stores.-fstrength-reduce-fstrict-aliasing-fstrict-enums-fstrict-overflow-fstrict-prototype-fstrict-volatile-bitfields-fstrong-eval-order-fstrong-eval-order=-fswitch-errors-fsync-libcalls-fsyntax-only-ftabstop=-ftail-call-workaround-ftail-call-workaround=-ftarget-help-ftemplate-backtrace-limit=-ftemplate-depth--ftemplate-depth=-ftest-coverage-ftest-forall-temp-fthis-is-variable-fthread-jumps-fthreadsafe-statics-ftime-report-ftime-report-details-ftls-model=-ftoplevel-reorder-ftracer-ftrack-macro-expansion-ftrack-macro-expansion=-ftrampolines-ftransition=all-ftransition=complex-ftransition=dip1000-ftransition=dip25-ftransition=field-ftransition=nogc-ftransition=tls-ftrapping-math-ftrapv-ftree-bit-ccp-ftree-builtin-call-dce-ftree-ccp-ftree-ch-ftree-coalesce-inlined-vars-ftree-coalesce-vars-ftree-copy-prop-ftree-copyrename-ftree-cselim-ftree-dce-ftree-dominator-opts-ftree-dse-ftree-forwprop-ftree-fre-ftree-loop-distribution-ftree-loop-if-convert-ftree-loop-if-convert-stores-ftree-loop-im-ftree-loop-ivcanon-ftree-loop-linear-ftree-loop-optimize-ftree-loop-vectorize-ftree-lrs-ftree-parallelize-loops=-ftree-partial-pre-ftree-phiprop-ftree-pre-ftree-pta-ftree-reassoc-ftree-salias-ftree-scev-cprop-ftree-sink-ftree-slp-vectorize-ftree-slsr-ftree-sra-ftree-store-ccp-ftree-store-copy-prop-ftree-switch-conversion-ftree-tail-mergeEnable tail merging on trees.-ftree-ter-ftree-vect-loop-version-ftree-vectorize-ftree-vectorizer-verbose=-ftree-vrp-funconstrained-commons-funderscoring-funit-at-a-time-funittestCompile in unittest code.-funroll-all-loops-funroll-completely-grow-size-funroll-loops-funsafe-loop-optimizations-funsafe-math-optimizations-funsigned-bitfields-funsigned-char-funswitch-loopsPerform loop unswitching.-funwind-tables-fuse-cxa-atexit-fuse-cxa-get-exception-ptr-fuse-ld=bfd-fuse-ld=gold-fuse-ld=lld-fuse-linker-plugin-fvar-trackingPerform variable tracking.-fvar-tracking-assignments-fvar-tracking-uninit-fvect-cost-model-fvect-cost-model=-fverbose-asm-fversion-fversion-loops-for-strides-fversion=-fvisibility-inlines-hidden-fvisibility-ms-compat-fvisibility=-fvpt-fvtable-gc-fvtable-thunks-fvtable-verify=-fvtv-counts-fvtv-debug-fweak-fweak-templates-fweb-fwhole-file-fwhole-program-fwide-exec-charset=-fworking-directory-fwpa=-fwrapv-fwrapv-pointer-fxref-fzee-fzero-call-used-regs=-fzero-initialized-in-bss-fzero-link-g-gantCatch typos.-gas-loc-support-gas-locview-support-gcoff-gcoff1-gcoff2-gcoff3-gcolumn-info-gdescribe-dies-gdwarf-gdwarf--gdwarf32-gdwarf64-gen-decls-ggdb-ggnu-pubnames-gimple-stats-ginline-points-gnat-gnatO-gno--gno-pubnames-gpubnames-grecord-gcc-switches-gsplit-dwarf-gstabs-gstabs+-gstatement-frontiers-gstrict-dwarf-gtoggle-gvariable-location-views-gvms-gxcoff-gxcoff+-gz-gz=-h-idirafter-imultiarch-imultilib-iplugindir=-iprefix-iquote-isysroot-isystem-iwithprefix-iwithprefixbefore-k8Synonym of -gnatk8.-l-lang-asm-m128bit-long-doublesizeof(long double) is 16.-m16Generate 16bit i386 code.-m32Generate 32bit i386 code.-m3dnow-m3dnowa-m64Generate 64bit x86-64 code.-m80387Use hardware fp.-m8bit-idiv-m96bit-long-doublesizeof(long double) is 12.-mabi=-mabm-maccumulate-outgoing-args-maddress-mode=Use given address mode.-madx-maes-malign-data=Use the given data alignment.-malign-double-malign-functions=-malign-jumps=-malign-loops=-malign-stringops-mamx-bf16-mamx-int8-mamx-tile-mandroid-march=Generate code for given CPU.-masm=Use given assembler dialect.-mavx-mavx2-mavx256-split-unaligned-load-mavx5124fmaps-mavx5124vnniw-mavx512bf16-mavx512bitalg-mavx512bw-mavx512cd-mavx512dq-mavx512er-mavx512f-mavx512ifma-mavx512pf-mavx512vbmi-mavx512vbmi2-mavx512vl-mavx512vnni-mavx512vp2intersect-mavx512vpopcntdq-mavxvnni-mbionicUse Bionic C library.-mbmi-mbmi2-mbranch-cost=-mcall-ms2sysv-xlogues-mcet-switch-mcld-mcldemote-mclflushopt-mclwbSupport CLWB instruction.-mclzero-mcmodel=Use given x86-64 code model.-mcpu=-mcrc32-mcx16-mdaz-ftzSet the FTZ and DAZ Flags.-mdispatch-scheduler-mdump-tune-features-menqcmd-mf16c-mfancy-math-387-mfentry-mfentry-name=-mfentry-section=-mfma-mfma4-mforce-drap-mforce-indirect-call-mfp-ret-in-387-mfpmath=-mfsgsbase-mfunction-return=-mfused-madd-mfxsr-mgather^use_gather-mgeneral-regs-only-mgfni-mglibcUse GNU C library.-mhard-float-mharden-sls=-mhle-mhreset-miamcu-mieee-fp-mincoming-stack-boundary=-mindirect-branch-cs-prefix-mindirect-branch-register-mindirect-branch=-minline-all-stringops-minstrument-return=-mintel-syntax-mkl-mlarge-data-threshold=-mlong-double-128Use 128-bit long double.-mlong-double-64Use 64-bit long double.-mlong-double-80Use 80-bit long double.-mlwp-mlzcnt-mmanual-endbr-mmemcpy-strategy=-mmemset-strategy=-mmitigate-rop-mmmx-mmovbe-mmovdir64b-mmovdiri-mmpx-mms-bitfields-mmuslUse musl C library.-mmwait-mmwaitx-mneeded-mno-align-stringops-mno-defaultClear all tune features.-mno-fancy-math-387-mno-push-args-mno-red-zone-mno-sse4-mnop-mcount-momit-leaf-frame-pointer-mpc32-mpc64-mpc80-mpclmul-mpcommit-mpconfig-mpku-mpopcnt-mprefer-avx128-mprefer-vector-width=-mpreferred-stack-boundary=-mprefetchwt1-mprfchw-mptwrite-mpush-args-mrdpid-mrdrnd-mrdseedSupport RDSEED instruction.-mrecip-mrecip=-mrecord-mcount-mrecord-return-mred-zone-mregparm=-mrtdAlternate calling convention.-mrtm-msahf-mserialize-msgx-msha-mshstk-mskip-rax-setup-msoft-floatDo not use hardware fp.-msse-msse2-msse2avx-msse3-msse4-msse4.1-msse4.2-msse4a-msse5%<-msse5%> was removed-msseregparm-mssse3-mstack-arg-probeEnable stack probing.-mstack-protector-guard-reg=-mstack-protector-guard=-mstackrealignRealign stack in prologue.-mstringop-strategy=-mstv-mtbm-mtls-dialect=-mtls-direct-seg-refs-mtsxldtrk-mtune-ctrl=-mtune=Schedule code for given CPU.-muclibcUse uClibc C library.-muintr-mvaes-mveclibabi=Vector library ABI to use.-mvect8-ret-in-mem-mvpclmulqdq-mvzeroupper-mwaitpkg-mwbnoinvd-mwidekl-mx32Generate 32bit x86-64 code.-mxop-mxsave-mxsavecSupport XSAVEC instructions.-mxsaveoptSupport XSAVEOPT instruction.-mxsaves-n-name-sort-no-pie-nocppDisable preprocessing.-nodefaultlibs-nolibc-nophoboslib-nostartfiles-nostdinc-nostdinc++-nostdlib-pEnable function profiling.-pg-posix-print-objc-runtime-info-print-sysroot-headers-suffix-print-value-pthread-quiet-r-rdynamic-remap-reverse-sort-s-save-temps=Create a shared library.-shared-libgcc-shared-libphobos-size-sort-static-libasan-static-libgcc-static-libgfortran-static-libgo-static-libhwasan-static-liblsan-static-libmpx-static-libmpxwrappers-static-libphobos-static-libstdc++-static-libtsan-static-libubsan-std=c++03-std=c++0x-std=c++11-std=c++14-std=c++17-std=c++1y-std=c++1z-std=c++20-std=c++23-std=c++2a-std=c++2b-std=c++98-std=c11-std=c17-std=c18-std=c1x-std=c2x-std=c89-std=c90-std=c99-std=c9x-std=f2003-std=f2008-std=f2008ts-std=f2018-std=f95-std=gnu-std=gnu++03-std=gnu++0x-std=gnu++11-std=gnu++14-std=gnu++17-std=gnu++1y-std=gnu++1z-std=gnu++20-std=gnu++23-std=gnu++2a-std=gnu++2b-std=gnu++98-std=gnu11-std=gnu17-std=gnu18-std=gnu1x-std=gnu2x-std=gnu89-std=gnu90-std=gnu99-std=gnu9x-std=iso9899:1990-std=iso9899:199409-std=iso9899:1999-std=iso9899:199x-std=iso9899:2011-std=iso9899:2017-std=iso9899:2018-std=legacy-stdlib=-t-tno-android-cc-tno-android-ld-tree-statsDump the statistics of trees.-type-stats-u-undef-vEnable verbose output.-wSuppress warnings.-wrapper-x-z-Wno--fno--mno--m--debug=--machine---machine-no---machine=--machine=no---machine--optimize=--std=--std--warn---warn-no---no-%s: error: too many @-files encountered %s: error: @-file refers to a directory Mach-O file found but no segment name specifiedMach-O file is not object filecould not create temporary filePEX_STDERR_TO_PIPE used in the middle of pipelineCannot create temporary file in %s: %s simple_object_copy_lto_debug_sections not implementedenvironment variable % must be setenvironment variable % must be setinstallation error, cannot find %LTO parallelism level set to %ld corrupted ltrans output file %susing serial compilation of %d LTRANS jobs @-touch -r %s %s.tem > /dev/null 2>&1 && mv %s.tem %s -fno-diagnostics-show-line-numbers-fdiagnostics-path-format=separate-eventsmalformed %could not open response file %scould not close response file %scould not write to response file %soption %s with different valuesoption %qs with mismatching values (%s, %s)option %s not used consistently in all LTO input filesExtra option to %<-Xassembler%>: %s, dropping all %<-Xassembler%> and %<-Wa%> options.Options to %<-Xassembler%> do not match: %s, %s, dropping all %<-Xassembler%> and %<-Wa%> options.%> is not present in %% environment variable is unsetKnown assembler dialects (for use with the -masm= option):unknown array bounds setting %qsKnown ABIs (for use with the -mabi= option):unknown Control-Flow Protection Level %qsKnown code models (for use with the -mcmodel= option):argument %qs to %<-Wbidi-chars%> not recognizedargument %qs to %<-Wnormalized%> not recognizedunknown excess precision style %qsunknown floating point contraction style %qsUnrecognized option to endianness value: %qsUnrecognized option to floating-point init value: %qsKnown choices for mitigation against straight line speculation with -mharden-sls=:Known indirect branch choices (for use with the -mindirect-branch=/-mfunction-return= options):Known choices for return instrumentation with -minstrument-return=:unrecognized ivar visibility value %qsKnown data alignment choices (for use with the -malign-data= option):Known vectorization library ABIs (for use with the -mveclibabi= option):unknown Live-Patching Level %qsunknown LTO partitioning model %qsunknown specification for the set of FLT_EVAL_METHOD values to permit %qsKnown address mode (for use with the -maddress-mode= option):Known preferred register vector length (to use with the -mprefer-vector-width= option):unknown profile reproducibility method %qsunknown profile update method %qsunknown basic block reordering algorithm %qsunrecognized scalar storage order value %qsKnown stack protector guard (for use with the -mstack-protector-guard= option):Valid arguments to -mstringop-strategy=:unrecognized visibility value %qsKnown TLS dialects (for use with the -mtls-dialect= option):unknown vectorizer cost model %qsunknown vtable verify initialization priority %qsargument %qs to %<-Waligned-new%> not recognizedProvide bash completion for options starting with provided string.--help= Display descriptions of a specific class of options. is one or more of optimizers, target, warnings, undocumented, params.--param=align-loop-iterations=Loops iterating at least selected number of iterations will get loop alignment.Select fraction of the maximal frequency of executions of basic block in function given basic block get alignment.--param=analyzer-bb-explosion-factor=The maximum number of 'after supernode' exploded nodes within the analyzer per supernode, before terminating analysis.--param=analyzer-max-constraints=The maximum number of constraints per state.--param=analyzer-max-enodes-for-full-dump=The maximum depth of exploded nodes that should appear in a dot dump before switching to a less verbose format.--param=analyzer-max-enodes-per-program-point=The maximum number of exploded nodes per program point within the analyzer, before terminating analysis of that point.--param=analyzer-max-infeasible-edges=The maximum number of infeasible edges to reject before declaring a diagnostic as infeasible.--param=analyzer-max-recursion-depth=The maximum number of times a callsite can appear in a call stack within the analyzer, before terminating analysis of a call that would recurse deeper.--param=analyzer-max-svalue-depth=The maximum depth of a symbolic value, before approximating the value as unknown.--param=analyzer-min-snodes-for-call-summary=The minimum number of supernodes within a function for the analyzer to consider summarizing its effects at call sites.Enable asan globals protection.--param=asan-instrument-allocas=Enable asan allocas/VLAs protection.--param=asan-instrument-reads=Enable asan load operations protection.--param=asan-instrument-writes=Enable asan store operations protection.--param=asan-instrumentation-with-call-threshold=Use callbacks instead of inline code if number of accesses in function becomes greater or equal to this number.Enable asan builtin functions protection.--param=asan-use-after-return=Enable asan detection of use-after-return bugs.Average number of iterations of a loop.Maximum number of bits for which we avoid creating FMAs.--param=builtin-expect-probability=Set the estimated probability in percentage for builtin expect. The default value is 90% probability.--param=builtin-string-cmp-inline-length=The maximum length of a constant string for a builtin string cmp call eligible for inlining. The default value is 3.--param=case-values-threshold=The smallest number of different values for which it is best to use a jump-table instead of a tree of conditional branches, if 0, use the default for the machine.--param=comdat-sharing-probability=Probability that COMDAT function will be shared with different compilation unit.--param=cxx-max-namespaces-for-diagnostic-help=Maximum number of namespaces to search for alternatives when name lookup fails.--param=dse-max-alias-queries-per-store=Maximum number of queries into the alias oracle per store.Maximum size (in bytes) of objects tracked bytewise by dead store elimination.Maximal estimated growth of function body caused by early inlining of single call.--param=evrp-mode=[legacy|ranger|legacy-first|ranger-first|ranger-trace|ranger-debug|trace|debug] Specifies the mode Early VRP should operate in.--param=evrp-sparse-threshold=Maximum number of basic blocks before EVRP uses a sparse cache.--param=fsm-maximum-phi-arguments=Maximum number of arguments a PHI may have before the FSM threader will not try to thread through its block.--param=fsm-scale-path-blocks=Scale factor to apply to the number of blocks in a threading path when comparing to the number of (scaled) statements.Scale factor to apply to the number of statements in a threading path when comparing to the number of (scaled) blocks.--param=gcse-after-reload-critical-fraction=The threshold ratio of critical edges execution count that permit performing redundancy elimination after reload.--param=gcse-after-reload-partial-fraction=The threshold ratio for performing partial redundancy elimination after reload.--param=gcse-cost-distance-ratio=Scaling factor in calculation of maximum distance an expression can be moved by GCSE optimizations.--param=gcse-unrestricted-cost=Cost at which GCSE optimizations will not constraint the distance an expression can travel.Minimum heap expansion to trigger garbage collection, as a percentage of the total size of the heap.Minimum heap size before we start collecting garbage, in kilobytes.--param=gimple-fe-computed-hot-bb-threshold=The number of executions of a basic block which is considered hot. The parameter is used only in GIMPLE FE.--param=graphite-allow-codegen-errors=Whether codegen errors should be ICEs when -fchecking.--param=graphite-max-arrays-per-scop=Maximum number of arrays per SCoP.--param=graphite-max-nb-scop-params=Maximum number of parameters in a SCoP.--param=hash-table-verification-limit=The number of elements for which hash table verification is done for each searched element.--param=hot-bb-count-fraction=The denominator n of fraction 1/n of the maximal execution count of a basic block in the entire program that a basic block needs to at least have in order to be considered hot (used in non-LTO mode).--param=hot-bb-count-ws-permille=The number of most executed permilles of the profiled execution of the entire program to which the execution count of a basic block must be part of in order to be considered hot (used in LTO mode).--param=hot-bb-frequency-fraction=The denominator n of fraction 1/n of the execution frequency of the entry block of a function that a basic block of this function needs to at least have in order to be considered hot.--param=hwasan-instrument-allocas=Enable hwasan instrumentation of allocas/VLAs.--param=hwasan-instrument-mem-intrinsics=Enable hwasan instrumentation of builtin functions.--param=hwasan-instrument-reads=Enable hwasan instrumentation of load operations.--param=hwasan-instrument-stack=Enable hwasan instrumentation of statically sized stack-allocated variables.--param=hwasan-instrument-writes=Enable hwasan instrumentation of store operations.--param=hwasan-random-frame-tag=Use random base tag for each frame, as opposed to base always zero.--param=inline-heuristics-hint-percent=The scale (in percents) applied to inline-insns-single and auto limits when heuristics hints that inlining is very profitable.The minimal estimated speedup allowing inliner to ignore inline-insns-single and inline-insns-auto.How much can given compilation unit grow because of the inlining (in percent).The upper bound for sharing integer constants.--param=ipa-cp-eval-threshold=Threshold ipa-cp opportunity evaluation that is still considered beneficial to clone.--param=ipa-cp-large-unit-insns=The size of translation unit that IPA-CP pass considers large.--param=ipa-cp-loop-hint-bonus=Compile-time bonus IPA-CP assigns to candidates which make loop bounds or strides known.--param=ipa-cp-max-recursive-depth=Maximum depth of recursive cloning for self-recursive function.--param=ipa-cp-min-recursive-probability=Recursive cloning only when the probability of call being executed exceeds the parameter.--param=ipa-cp-recursion-penalty=Percentage penalty the recursive functions will receive when they are evaluated for cloning.--param=ipa-cp-single-call-penalty=Percentage penalty functions containing a single call to another function will receive when they are evaluated for cloning.How much can given compilation unit grow because of the interprocedural constant propagation (in percent).--param=ipa-cp-value-list-size=Maximum size of a list of values associated with each parameter for interprocedural constant propagation.--param=ipa-jump-function-lookups=Maximum number of statements visited during jump function offset discovery.Maximum number of statements that will be visited by IPA formal parameter analysis based on alias analysis in any given function.Maximum number of aggregate content items for a parameter in jump functions and lattices.--param=ipa-max-loop-predicates=Maximum number of different predicates used to track properties of loops in IPA analysis.--param=ipa-max-param-expr-ops=Maximum number of operations in a parameter expression that can be handled by IPA analysis.--param=ipa-max-switch-predicate-bounds=Maximal number of boundary endpoints of case ranges of switch statement used during IPA function summary generation.--param=ipa-sra-max-replacements=Maximum pieces that IPA-SRA tracks per formal parameter, as a consequence, also the maximum number of replacements of a formal parameter.--param=ipa-sra-ptr-growth-factor=Maximum allowed growth of number and total size of new parameters that ipa-sra replaces a pointer to an aggregate with.--param=ira-loop-reserved-regs=The number of registers in each class kept unused by loop invariant motion.--param=ira-max-conflict-table-size=Max size of conflict table in MB.Max loops number for regional RA.--param=iv-always-prune-cand-set-bound=If number of candidates in the set is smaller, we always try to remove unused ivs during its optimization.--param=iv-consider-all-candidates-bound=Bound on number of candidates below that all candidates are considered in iv optimizations.--param=iv-max-considered-uses=Bound on number of iv uses in loop optimized in iv optimizations.--param=jump-table-max-growth-ratio-for-size=The maximum code size growth ratio when expanding into a jump table (in percent). The parameter is used when optimizing for size.--param=jump-table-max-growth-ratio-for-speed=The maximum code size growth ratio when expanding into a jump table (in percent). The parameter is used when optimizing for speed.--param=large-function-growth=Maximal growth due to inlining of large function (in percent).The size of function body to be considered large.--param=large-stack-frame-growth=Maximal stack frame growth due to inlining (in percent).The size of stack frame to be considered large.The size of translation unit to be considered large.Maximum number of concurrently open C++ module files when lazy loading.The minimum cost of an expensive expression in the loop invariant motion.--param=logical-op-non-short-circuit=True if a non-short-circuit operation is optimal.Size of tiles for loop blocking.--param=loop-interchange-max-num-stmts=The maximum number of stmts in loop nest for loop interchange.--param=loop-interchange-stride-ratio=The minimum stride ratio for loop interchange to be profitable.--param=loop-invariant-max-bbs-in-loop=Max basic blocks number in loop for loop invariant motion.--param=loop-max-datarefs-for-datadeps=Maximum number of datarefs in loop for building loop data dependencies.--param=loop-versioning-max-inner-insns=The maximum number of instructions in an inner loop that is being considered for versioning.--param=loop-versioning-max-outer-insns=The maximum number of instructions in an outer loop that is being considered for versioning, on top of the instructions in inner loops.--param=lra-inheritance-ebb-probability-cutoff=Minimal fall-through edge probability in percentage used to add BB to inheritance EBB in LRA.--param=lra-max-considered-reload-pseudos=The max number of reload pseudos which are considered during spilling a non-reload pseudo.Maximal size of a partition for LTO (in estimated instructions).--param=lto-max-streaming-parallelism=maximal number of LTO partitions streamed in parallel.Minimal size of a partition for LTO (in estimated instructions).Number of partitions the program should be split to.--param=max-average-unrolled-insns=The maximum number of instructions to consider to unroll in a loop on average.The maximum number of insns combine tries to combine.--param=max-completely-peel-loop-nest-depth=The maximum depth of a loop nest we completely peel.--param=max-completely-peel-times=The maximum number of peelings of a single loop that is peeled completely.--param=max-completely-peeled-insns=The maximum number of insns of a completely peeled loop.The maximum number of incoming edges to consider for crossjumping.The maximum instructions CSE process before flushing.The maximum length of path considered in cse.--param=max-cselib-memory-locations=The maximum memory locations recorded by cselib.--param=max-debug-marker-count=Max. count of debug markers to expand or inline.--param=max-delay-slot-insn-search=The maximum number of instructions to consider to fill a delay slot.--param=max-delay-slot-live-search=The maximum number of instructions to consider to find accurate live register information.--param=max-dse-active-local-stores=Maximum number of active local stores in RTL dead store elimination.--param=max-early-inliner-iterations=The maximum number of nested indirect inlining performed by early inliner.--param=max-fields-for-field-sensitive=Maximum number of fields in a structure before pointer analysis treats the structure as a single variable.--param=max-find-base-term-values=Maximum number of VALUEs handled during a single find_base_term call.--param=max-fsm-thread-length=Maximum number of basic blocks on a finite state automaton jump thread path.--param=max-fsm-thread-path-insns=Maximum number of instructions to copy when duplicating blocks on a finite state automaton jump thread path.Maximum number of new jump thread paths to create for a finite state automaton.--param=max-gcse-insertion-ratio=The maximum ratio of insertions to deletions of expressions in GCSE.The maximum amount of memory to be allocated by GCSE, in kilobytes.--param=max-goto-duplication-insns=The maximum number of insns to duplicate when unfactoring computed gotos.--param=max-grow-copy-bb-insns=The maximum expansion factor when copying basic blocks.Maximum depth of search in the dominator tree for expressions to hoist.--param=max-inline-insns-auto=The maximum number of instructions when automatically inlining.--param=max-inline-insns-recursive-auto=The maximum number of instructions non-inline function can grow to via recursive inlining.--param=max-inline-insns-recursive=The maximum number of instructions inline function can grow to via recursive inlining.--param=max-inline-insns-single=The maximum number of instructions in a single function eligible for inlining.--param=max-inline-insns-size=The maximum number of instructions when inlining for size.--param=max-inline-insns-small=The maximum number of instructions when automatically inlining small functions.--param=max-inline-recursive-depth-auto=The maximum depth of recursive inlining for non-inline functions.--param=max-inline-recursive-depth=The maximum depth of recursive inlining for inline functions.Maximum number of isl operations, 0 means unlimited.--param=max-iterations-computation-cost=Bound on the cost of an expression to compute the number of iterations.--param=max-iterations-to-track=Bound on the number of iterations the brute force # of iterations analysis algorithm evaluates.--param=max-jump-thread-duplication-stmts=Maximum number of statements allowed in a block that needs to be duplicated when threading jumps.The maximum number of RTL nodes that can be recorded as combiner's last value.--param=max-loop-header-insns=The maximum number of insns in loop header duplicated by the copy loop headers pass.--param=max-modulo-backtrack-attempts=The maximum number of backtrack attempts the scheduler should make when modulo scheduling a loop.--param=max-partial-antic-length=Maximum length of partial antic set when performing tree pre optimization.The maximum number of branches on the path through the peeled sequence.The maximum number of peelings of a single loop.The maximum number of insns of a peeled loop.--param=max-pending-list-length=The maximum length of scheduling's pending operations list.--param=max-pipeline-region-blocks=The maximum number of blocks in a region to be considered for interblock scheduling.--param=max-pipeline-region-insns=The maximum number of insns in a region to be considered for interblock scheduling.Maximum depth of sqrt chains to use when synthesizing exponentiation by a real constant.--param=max-predicted-iterations=The maximum number of loop iterations we predict statically.--param=max-reload-search-insns=The maximum number of instructions to search backward when looking for equivalent reload.--param=max-rtl-if-conversion-insns=Maximum number of insns in a basic block to consider for RTL if-conversion.--param=max-rtl-if-conversion-predictable-cost=Maximum permissible cost for the sequence that would be generated by the RTL if-conversion pass for a branch that is considered predictable.--param=max-rtl-if-conversion-unpredictable-cost=Maximum permissible cost for the sequence that would be generated by the RTL if-conversion pass for a branch that is considered unpredictable.--param=max-sched-extend-regions-iters=The maximum number of iterations through CFG to extend regions.--param=max-sched-insn-conflict-delay=The maximum conflict delay for an insn to be considered for speculative motion.--param=max-sched-ready-insns=The maximum number of instructions ready to be issued to be considered by the scheduler during the first scheduling pass.--param=max-sched-region-blocks=--param=max-sched-region-insns=Maximum length of candidate scans for straight-line strength reduction.--param=max-speculative-devirt-maydefs=Maximum number of may-defs visited when devirtualizing speculatively.--param=max-ssa-name-query-depth=Maximum recursion depth allowed when querying a property of an SSA name.--param=max-store-chains-to-track=Maximum number of store chains to track at the same time in the store merging pass.Maximum number of constant stores to merge in the store merging pass.Maximum number of conditional store pairs that can be sunk.--param=max-tail-merge-comparisons=Maximum amount of similar bbs to compare a bb with.--param=max-tail-merge-iterations=Maximum amount of iterations of the pass over a function.Maximum number of strings for which strlen optimization pass will track string lengths.--param=max-tree-if-conversion-phi-args=Maximum number of arguments in a PHI supported by TREE if-conversion unless the loop is marked with simd pragma.The maximum number of unrollings of a single loop.The maximum number of instructions to consider to unroll in a loop.The maximum number of insns of an unswitched loop.The maximum number of unswitchings in a single loop.--param=max-variable-expansions-in-unroller=If -fvariable-expansion-in-unroller is used, the maximum number of times that an individual variable will be expanded during loop unrolling.--param=max-vartrack-expr-depth=Max. recursion depth for expanding var tracking expressions.--param=max-vartrack-reverse-op-size=Max. size of loc list for which reverse ops should be added.Max. size of var tracking hash tables.--param=max-vrp-switch-assertions=Maximum number of assertions to add along the default edge of a switch statement during VRP.The minimum number of matching instructions to consider for crossjumping.--param=min-inline-recursive-probability=Inline recursively only when the probability of call being executed exceeds the parameter.--param=min-insn-to-prefetch-ratio=Min. ratio of insns to prefetches to enable prefetching for a loop with an unknown trip count.--param=min-loop-cond-split-prob=The minimum threshold for probability of semi-invariant condition statement to trigger loop split.--param=min-nondebug-insn-uid=The minimum UID to be used for a nondebug insn.Minimum page size for warning purposes.--param=min-size-for-stack-sharing=The minimum size of variables taking part in stack slot sharing when not optimizing.The minimum probability of reaching a source block for interblock speculative scheduling.If -ftree-vectorize is used, the minimal loop bound of a loop to be considered for vectorization.Maximum number of accesses stored in each modref reference.Maximum number of bases stored in each modref tree.Maximum depth of DFS walk used by modref escape analysis.--param=modref-max-escape-points=Maximum number of escape points tracked by modref per SSA-name.Maximum number of references stored in each modref base.Maximum number of tests performed by modref query.--param=openacc-kernels=[decompose|parloops] Specify mode of OpenACC 'kernels' constructs handling.Chunk size of omp schedule for loops parallelized by parloops.--param=parloops-min-per-thread=Minimum number of iterations per thread of an innermost parallelized loop.--param=parloops-schedule=[static|dynamic|guided|auto|runtime] Schedule type of omp schedule for loops parallelized by parloops.--param=partial-inlining-entry-probability=Maximum probability of the entry BB of split region (in percent relative to entry BB of the function) to make partial inlining happen.--param=predictable-branch-outcome=Maximal estimated outcome of branch considered predictable.--param=prefetch-dynamic-strides=Whether software prefetch hints should be issued for non-constant strides.The number of insns executed before prefetch is completed.--param=prefetch-min-insn-to-mem-ratio=Min. ratio of insns to mem ops to enable prefetching in a loop.--param=prefetch-minimum-stride=The minimum constant stride beyond which we should use prefetch hints for.--param=profile-func-internal-id=Use internal function id in profile lookup.Maximum depth of logical expression evaluation ranger will look through when evaluating outgoing edge ranges.--param=rpo-vn-max-loop-depth=Maximum depth of a loop nest to fully value-number optimistically.--param=sccvn-max-alias-queries-per-access=Maximum number of disambiguations to perform per memory access.--param=scev-max-expr-complexity=Bound on the complexity of the expressions in the scalar evolutions analyzer.Bound on size of expressions used in the scalar evolutions analyzer.--param=sched-autopref-queue-depth=Hardware autoprefetcher scheduler model control flag. Number of lookahead cycles the model looks into, at '0' only enable instruction sorting heuristic. Disabled by default.--param=sched-mem-true-dep-cost=Minimal distance between possibly conflicting store and load.--param=sched-pressure-algorithm=Which -fsched-pressure algorithm to apply.--param=sched-spec-prob-cutoff=The minimal probability of speculation success (in percents), so that speculative insn will be scheduled.--param=sched-state-edge-prob-cutoff=The minimum probability an edge must have for the scheduler to save its state across it.--param=selsched-insns-to-rename=Maximum number of instructions in the ready list that are considered eligible for renaming.--param=selsched-max-lookahead=The maximum size of the lookahead window of selective scheduling.--param=selsched-max-sched-times=Maximum number of times that an insn could be scheduled.--param=simultaneous-prefetches=The number of prefetches that can run at the same time.--param=sink-frequency-threshold=Target block's relative execution frequency (as a percentage) required to sink a statement.The number of cycles the swing modulo scheduler considers when checking conflicts using DFA.--param=sms-loop-average-count-threshold=A threshold on the average loop count considered by the swing modulo scheduler.A factor for tuning the upper bound that swing modulo scheduler uses for scheduling a loop.The minimum value of stage count that swing modulo scheduler will generate.Maximum number of artificial accesses to enable forward propagation that Scalar Replacement of Aggregates will keep for one local variable.--param=sra-max-scalarization-size-Osize=Maximum size, in storage units, of an aggregate which should be considered for scalarization when compiling for size.--param=sra-max-scalarization-size-Ospeed=Maximum size, in storage units, of an aggregate which should be considered for scalarization when compiling for speed.--param=ssa-name-def-chain-limit=The maximum number of SSA_NAME assignments to follow in determining a value.The lower bound for a buffer to be considered for stack smashing protection.--param=stack-clash-protection-guard-size=Size of the stack guard expressed as a power of two in bytes.--param=stack-clash-protection-probe-interval=Interval in which to probe the stack expressed as a power of two in bytes.--param=store-merging-allow-unaligned=Allow the store merging pass to introduce unaligned stores if it is legal to do so.--param=store-merging-max-size=Maximum size of a single store merging region in bytes.--param=switch-conversion-max-branch-ratio=The maximum ratio between array size and switch branches for a switch conversion to take place.--param=tm-max-aggregate-size=Size in bytes after which thread-local aggregates should be instrumented with the logging functions instead of save/restore pairs.--param=tracer-dynamic-coverage-feedback=The percentage of function, weighted by execution frequency, that must be covered by trace formation. Used when profile feedback is available.--param=tracer-dynamic-coverage=The percentage of function, weighted by execution frequency, that must be covered by trace formation. Used when profile feedback is not available.--param=tracer-max-code-growth=Maximal code growth caused by tail duplication (in percent).--param=tracer-min-branch-probability-feedback=Stop forward growth if the probability of best edge is less than this threshold (in percent). Used when profile feedback is available.--param=tracer-min-branch-probability=Stop forward growth if the probability of best edge is less than this threshold (in percent). Used when profile feedback is not available.--param=tracer-min-branch-ratio=Stop reverse growth if the reverse probability of best edge is less than this threshold (in percent).Set the maximum number of instructions executed in parallel in reassociated tree. If 0, use the target dependent heuristic.--param=tsan-distinguish-volatile=Emit special instrumentation for accesses to volatiles.--param=tsan-instrument-func-entry-exit=Emit instrumentation calls to __tsan_func_entry() and __tsan_func_exit().--param=uninit-control-dep-attempts=Maximum number of nested calls to search for control dependencies during uninitialized variable analysis.--param=uninlined-function-insns=Instruction accounted for function prologue, epilogue and other overhead.--param=uninlined-function-time=Time accounted for function prologue, epilogue and other overhead.--param=uninlined-thunk-insns=Instruction accounted for function thunk overhead.Time accounted for function thunk overhead.--param=unlikely-bb-count-fraction=The denominator n of fraction 1/n of the number of profiled runs of the entire program below which the execution count of a basic block must be in order for the basic block to be considered unlikely.--param=unroll-jam-max-unroll=Maximum unroll factor for the unroll-and-jam transformation.--param=unroll-jam-min-percent=Minimum percentage of memrefs that must go away for unroll-and-jam to be considered profitable.--param=use-after-scope-direct-emission-threshold=Use direct poisoning/unpoisoning instructions for variables smaller or equal to this number.Whether to use canonical types.--param=vect-epilogues-nomask=Enable loop epilogue vectorization using smaller vector size.--param=vect-max-peeling-for-alignment=Maximum number of loop peels to enhance alignment of data references in a loop.--param=vect-max-version-for-alias-checks=Bound on number of runtime checks inserted by the vectorizer's loop versioning for alias check.--param=vect-max-version-for-alignment-checks=Bound on number of runtime checks inserted by the vectorizer's loop versioning for alignment check.--param=vect-partial-vector-usage=Controls how loop vectorizer uses partial vectors. 0 means never, 1 means only for loops whose need to iterate can be removed, 2 means for all loops. The default value is 2.--print-missing-file-dependencies--print-sysroot-headers-suffix-A= Assert the to . Putting '-' before disables the to .Do not discard comments in macro expansions.-D[=] Define a with as its value. If just is given, is taken to be 1.-F Add to the end of the main framework include path.Print the name of header files as they are used.-Hd Write D interface files to directory .-Hf Write D interface to .-I Add to the end of the main include path.-J Put MODULE files in 'directory'.Generate make dependencies and compile.-MF Write dependency output to the given file.Treat missing header files as generated files.Like -M but ignore system header files.Like -MD but ignore system header files.Generate phony targets for all headers.-MQ Add a target that may require quoting.missing makefile target after %qs-MT Add a target that does not require quoting.Generate C++ Module dependency information.-O Set optimization level to .Optimize for speed disregarding exact standards compliance.Optimize for debugging experience rather than speed or size.Optimize for space rather than speed.Do not generate #line directives.This switch is deprecated; use -Wextra instead.Warn if the NSObject attribute is applied to a non-typedef.Warn about things that will change when compiling with an ABI-compliant compiler.Warn if a subobject has an abi_tag attribute that the complete object type does not have.Warn about things that change between the current -fabi-version and the specified version.Warn on suspicious calls of standard functions computing absolute values.Warn about suspicious uses of memory addresses.Warn when the address of packed member of struct or union is taken.Warn about returning structures, unions or arrays.-Waggressive-loop-optimizationsWarn if a loop with constant number of iterations triggers undefined behavior.Warn about possible aliasing of dummy arguments.Warn about alignment of COMMON blocks.Warn about 'new' of type with extended alignment without -faligned-new.-Waligned-new=[none|global|all] Warn even if 'new' uses a class member allocation function.-Walloc-size-larger-than= Warn for calls to allocation functions that attempt to allocate objects larger than the specified number of bytes.Warn for calls to allocation functions that specify zero bytes.-Walloca-larger-than= Warn on unbounded uses of alloca, and on bounded uses of alloca whose bound can be larger than bytes.Warn about missing ampersand in continued character constants.Warn about code paths in which a stdio FILE can be closed more than once.Warn about code paths in which a pointer can be freed more than once.-Wanalyzer-exposure-through-output-fileWarn about code paths in which sensitive data is written to a file.Warn about code paths in which a stdio FILE is not closed.Warn about code paths in which a non-heap pointer is freed.Warn about code paths in which a heap-allocated pointer leaks.-Wanalyzer-mismatching-deallocationWarn about code paths in which the wrong deallocation function is called.Warn about code paths in which NULL is passed to a must-not-be-NULL function argument.Warn about code paths in which a NULL pointer is dereferenced.-Wanalyzer-possible-null-argumentWarn about code paths in which a possibly-NULL value is passed to a must-not-be-NULL function argument.-Wanalyzer-possible-null-dereferenceWarn about code paths in which a possibly-NULL pointer is dereferenced.-Wanalyzer-shift-count-negativeWarn about code paths in which a shift with negative count is attempted.-Wanalyzer-shift-count-overflowWarn about code paths in which a shift with count >= width of type is attempted.-Wanalyzer-stale-setjmp-bufferWarn about code paths in which a longjmp rewinds to a jmp_buf saved in a stack frame that has returned.-Wanalyzer-tainted-array-indexWarn about code paths in which an unsanitized value is used as an array index.Warn if the code is too complicated for the analyzer to fully explore.-Wanalyzer-unsafe-call-within-signal-handlerWarn about code paths in which an async-signal-unsafe function is called from a signal handler.Warn about code paths in which a freed value is used.-Wanalyzer-use-of-pointer-in-stale-stack-frameWarn about code paths in which a pointer to a stale stack frame is used.Warn about code paths which attempt to write to a const object.-Wanalyzer-write-to-string-literalWarn about code paths which attempt to write to a string literal.Does nothing. Preserved for backward compatibility.Warn if conversion of the result of arithmetic might change the value even though converting the operands cannot.Warn if an array is accessed out of bounds.Warn about mismatched declarations of array parameters and unsafe accesses to them.Warn about creation of array temporaries.Warn whenever an Objective-C assignment is being intercepted by the garbage collector.Warn about type safety and similar errors and mismatches in declarations with alias attributes.Warn about uses of __attribute__((warning)) declarations.Warn about inappropriate attribute usage.Warn about casting functions to incompatible types.-Wbidi-chars=[none|unpaired|any] Warn about UTF-8 bidirectional control characters.Warn about boolean expression compared with an integer value different from true/false.Warn about certain operations on boolean expressions.-Wbuiltin-declaration-mismatchWarn when a built-in function is declared with the wrong signature.Warn when a built-in preprocessor macro is undefined or redefined.Warn about C constructs that are not in the common subset of C and C++.Warn about C++ constructs whose meaning differs between ISO C++ 1998 and ISO C++ 2011.Warn about C++ constructs whose meaning differs between ISO C++ 2011 and ISO C++ 2014.Warn about C++ constructs whose meaning differs between ISO C++ 2014 and ISO C++ 2017.Warn about C++ constructs whose meaning differs between ISO C++ 2017 and ISO C++ 2020.Warn if the type of a variable might be not interoperable with C.Warn about features not present in ISO C11, but present in ISO C2X.Warn about features not present in ISO C90, but present in ISO C99.Warn about features not present in ISO C99, but present in ISO C11.Warn when profiling instrumentation was requested, but could not be applied to a certain function.Warn about pointer casts which increase alignment.Warn about casts between incompatible function types.Warn about casts which discard qualifiers.Warn about casts that will produce a null result.Warn about catch handlers of non-reference type.Warn about subscripts whose type is "char".Warn about truncated character expressions.Removed in GCC 9. This switch has no effect.Warn when a conversion function will never be called due to the type it converts to.Warn for unsafe raw memory writes to objects of class types.Warn about variables that might be changed by "longjmp" or "vfork".Warn about uses of a comma operator within a subscripting expression.Warn about possibly nested block comments, and C++ comments spanning more than one physical line.Warn about equality comparisons involving REAL or COMPLEX expressions.Warn for conditionally-supported constructs.Warn for implicit type conversions that may change a value.Warn about most implicit conversions.Warn for converting NULL from/to a non-pointer type.Warn in case profiles in -fprofile-use do not match.Warn when a #warning directive is encountered.Warn when performing class template argument deduction on a type with no deduction guides.Warn when all constructors and destructors are private.Warn about __TIME__, __DATE__ and __TIMESTAMP__ usage.Warn when a declaration is found after a statement.Warn when deleting a pointer to incomplete type.Warn about deleting polymorphic objects with non-virtual destructors.Warn if a deprecated compiler feature, class, method, or field is used.Mark implicitly-declared copy operations as deprecated if the class has a user-provided copy operation.Mark implicitly-declared copy operations as deprecated if the class has a user-provided copy operation or destructor.Warn about uses of __attribute__((deprecated)) declarations.-Wdeprecated-enum-enum-conversionWarn about deprecated arithmetic conversions on operands of enumeration types.-Wdeprecated-enum-float-conversionWarn about deprecated arithmetic conversions on operands where one is of enumeration type and the other is of a floating-point type.Warn about positional initialization of structs requiring designated initializers.Warn when an optimization pass is disabled.Warn if qualifiers on arrays which are pointer targets are discarded.Warn if type qualifiers on pointers are discarded.Warn about compile-time integer division by zero.Warn about possibly incorrect subscripts in do loops.Warn about implicit conversions from "float" to "double".Warn when a declaration has duplicate const, volatile, restrict or _Atomic specifier.Warn about duplicated branches in if-else statements.Warn about duplicated conditions in an if-else-if chain.Warn about violations of Effective C++ style rules.Warn about an empty body in an if or else statement.Warn about stray tokens after #else and #endif.Warn about comparison of different enum types.Warn about implicit conversion of enum types.-Werror-implicit-function-declarationThis switch is deprecated; use -Werror=implicit-function-declaration instead.Treat specified warning as error.Warn when an exception handler is shadowed by another handler.Warn if "defined" is used outside #if.Print extra (possibly unwanted) warnings.Warn about semicolon after in-class function definition.Exit on the first error occurred.Warn for implicit type conversions that cause loss of floating point precision.Warn if testing floating point numbers for equality.Warn about printf/scanf/strftime/strfmon format string anomalies.Warn about format strings that contain NUL bytes.Warn about GCC format strings with strings unsuitable for diagnostics.Warn if passing too many arguments to a function for its format string.Warn about format strings that are not literals.Warn about function calls with format strings that write past the end of the destination region. Same as -Wformat-overflow=1.Warn about function calls with format strings that write past the end of the destination region.Warn about possible security problems with format functions.Warn about sign differences with format functions.Warn about calls to snprintf and similar functions that truncate output. Same as -Wformat-truncation=1.Warn about calls to snprintf and similar functions that truncate output.Warn about strftime formats yielding 2-digit years.Warn about zero-length formats.Warn when __builtin_frame_address or __builtin_return_address is used unsafely.-Wframe-larger-than= Warn if a function's stack frame requires in excess of .Warn when attempting to free a non-heap object.Warn if loops have been interchanged.Warn about function call elimination.Does nothing. Preserved for backward compatibility.Warn when the field in a struct is not aligned.Warn whenever attributes are ignored.Warn whenever type qualifiers are ignored.Warn about implicit declarations.Warn when a switch case falls through.-Wimplicit-function-declarationWarn about implicit function declarations.Warn when a declaration does not specify a type.Warn about calls with implicit interface.Warn about called procedures not explicitly declared.Warn when a base is inaccessible in derived due to ambiguity.Warn when there is a conversion between pointers that have incompatible types.Warn about C++11 inheriting constructors when the base has a variadic constructor.Warn about uses of std::initializer_list that can result in dangling pointers.Warn about variables which are initialized to themselves.Warn when an inlined function cannot be inlined.Warn about incompatible integer to pointer and pointer to integer conversions.Warn for suspicious integer expressions in boolean context.Warn when there is a cast to a pointer from an integer of a different size.Warn about constant integer divisions with truncated results.Warn if a user-procedure has the same name as an intrinsic.Warn on intrinsics not part of the selected standard.Warn about macros that have conflicting header units definitions.Warn when an atomic memory model parameter is known to be outside the valid range.Warn about invalid uses of the "offsetof" macro.Warn about PCH files that are found but not used.Warn when a jump misses a variable initialization.-Wlarger-than= Warn if an object's size exceeds .Warn about truncated source lines.Warn when a string or character literal is followed by a ud-suffix which does not begin with an underscore.Warn when logical not is used on the left hand side operand of a comparison.Warn when a logical operator is suspiciously always evaluating to true or false.Do not warn about using "long long" when -pedantic.During link time optimization warn about mismatched types of global declarations.Warn about suspicious declarations of "main".Warn about maybe uninitialized automatic variables.Warn about suspicious calls to memset where the third argument contains the number of elements not multiplied by the element size.Warn about suspicious calls to memset where the third argument is constant literal zero and the second is not.Warn when the indentation of the code does not reflect the block structure.Warn for deallocation calls with arguments returned from mismatched allocation functions.Warn for mismatches between calls to operator new or delete and the corresponding call to the allocation or deallocation function.Warn when a class is redeclared or referenced using a mismatched class-key.Warn about declarations of entities that may be missing attributes that related entities have been declared with.Warn about possibly missing braces around initializers.Warn about global functions without previous declarations.Warn about missing fields in struct initializers.Warn about user-specified include directories that do not exist.Warn that the lower bound of a missing index will be used.Warn about function parameters declared without a type specifier in K&R-style functions.Warn in case profiles in -fprofile-use do not exist.Warn about global functions without prototypes.Warn about use of multi-character character constants.Warn on direct multiple inheritance.Warn about unsafe macros expanding to multiple statements used as a body of a clause such as if, else, while, switch, or for.Warn about narrowing conversions within { } that are ill-formed in C++11.Warn about "extern" declarations not at file scope.Disable Walloc-size-larger-than= warning. Equivalent to Walloc-size-larger-than= or larger.Disable Walloca-larger-than= warning. Equivalent to Walloca-larger-than= or larger.Disable -Wframe-larger-than= warning. Equivalent to -Wframe-larger-than= or larger.Disable -Wlarger-than= warning. Equivalent to -Wlarger-than= or larger.Disable Wstack-usage= warning. Equivalent to Wstack-usage= or larger.Disable Wvla-larger-than= warning. Equivalent to Wvla-larger-than= or larger.Warn when a noexcept expression evaluates to false even though the expression can't actually throw.Warn if C++17 noexcept function type will change the mangled name of a symbol.Warn when non-templatized friend functions are declared within a template.Warn about non-virtual destructors.Warn about NULL being passed to argument slots marked as requiring non-NULL.Warn if comparing pointer parameter with nonnull attribute with NULL.-Wnormalized=[none|id|nfc|nfkc] Warn about non-normalized Unicode strings.Warn if dereferencing a NULL pointer may lead to erroneous or undefined behavior.Warn if a class interface has no superclass. Root classes may use an attribute to suppress this warning.Warn about some C++ One Definition Rule violations during link time optimization.Warn if a C-style cast is used in a program.Warn for obsolescent usage in a declaration.Warn if an old-style parameter definition is used.Warn if a simd directive is overridden by the vectorizer cost model.Warn about overflow in arithmetic expressions.Warn if a string is longer than the maximum portable length specified by the standard.Warn about overloaded virtual function names.Warn about overriding initializers without side effects.Warn about overriding initializers with side effects.Warn that -fno-automatic may break recursion.Warn when the packed attribute has no effect on struct layout.Warn about packed bit-fields whose offset changed in GCC 4.4.Warn when fields in a struct with the packed attribute are misaligned.Warn when padding is required to align structure members.Warn about possibly missing parentheses.Issue warnings needed for strict compliance to the standard.Warn about calling std::move on a local object in a return statement preventing copy elision.Warn for placement new expressions with undefined behavior.Warn when converting the type of pointers to member functions.Warn about function pointer arithmetic.Warn when a pointer is compared with a zero character constant.Warn when a pointer differs in signedness in an assignment.Warn when a pointer is cast to an integer of a different size.Warn about misuses of pragmas.Warn if constructor or destructors with priorities from 0 to 100 are used.Warn if a property for an Objective-C object has no assign semantics specified.Warn if inherited methods are unimplemented.Warn when a range-based for-loop is creating unnecessary copies.Warn about real-literal-constants with 'q' exponent-letter.Warn when a left-hand-side array variable is reallocated.Warn when a left-hand-side variable is reallocated.Warn about multiple declarations of the same object.Warn about redundant calls to std::move.Warn when a class or enumerated type is referenced using a redundant class-key.Warn about uses of register storage specifier.Warn when the compiler reorders code.Warn when an argument passed to a restrict-qualified parameter aliases with another argument.Warn about returning a pointer/reference to a local or temporary variable.Warn whenever a function's return type defaults to "int" (C), or about inconsistent return types (C++).Warn on suspicious constructs involving reverse scalar storage order.Warn if a selector has multiple methods.Warn about possible violations of sequence point rules.Warn when one variable shadows another. Same as -Wshadow=global.Warn if a local declaration hides an instance variable.Warn when one local variable shadows another local variable or parameter of compatible type.Warn when one variable shadows another (globally).Warn when one local variable shadows another local variable or parameter.Warn if shift count is negative.Warn if shift count >= width of type.Warn if left shifting a negative value.Warn if left shift of a signed value overflows.Warn about signed-unsigned comparisons.Warn for implicit type conversions between signed and unsigned integers.Warn when overload promotes from unsigned to signed.Warn about missing sized deallocation functions.Warn when sizeof is applied on a parameter declared as an array.Warn about divisions of two sizeof operators when the first one is applied to an array and the divisor does not equal the size of the array element.Warn about suspicious divisions of two sizeof expressions that don't work correctly with pointers.Warn about suspicious length parameters to certain string functions if the argument uses sizeof.Warn from speculative compiles such as __traits(compiles).Warn when not issuing stack smashing protection for some reason.-Wstack-usage= Warn if stack usage might exceed .Warn about code which might break strict aliasing rules.Warn about uncasted NULL used as sentinel.Warn about optimizations that assume that signed overflow is undefined.Warn about unprototyped function declarations.Warn if type signatures of candidate methods do not match exactly.Warn about calls to strcmp and strncmp used in equality expressions that are necessarily true or false due to the length of one and size of the other argument.Warn about buffer overflow in string manipulation functions like memcpy and strcpy.Under the control of Object Size type, warn about buffer overflow in string manipulation functions like memcpy and strcpy.Warn about reading past the end of a source array in string manipulation functions like memchr and memcpy.Warn about truncation in string manipulation functions like strncat and strncpy.Warn if a class type has a base or a field whose type uses the anonymous namespace or depends on a type with no linkage.Warn about functions which might be candidates for __attribute__((cold)).Warn about functions which might be candidates for __attribute__((const)).Warn about functions which might be candidates for format attributes.Warn about functions which might be candidates for __attribute__((malloc)).Warn about functions which might be candidates for __attribute__((noreturn)).Warn about functions which might be candidates for __attribute__((pure)).Warn about C++ virtual methods where adding final keyword would improve code quality.Warn about C++ polymorphic types where adding final keyword would improve code quality.Suggest that the override keyword be used when the declaration of a virtual function overrides another.Warn about "suspicious" constructs.Warn about enumerated switches, with no default, missing a case.Warn about switches with boolean controlling expression.Warn about enumerated switches missing a "default:" statement.Warn about all enumerated switches missing a specific case.Warn about switch values that are outside of the switch's type range.Warn about statements between switch's controlling expression and the first case.Warn when __sync_fetch_and_nand and __sync_nand_and_fetch built-in functions are used.Deprecated. This switch has no effect.Do not suppress warnings from system headers.Permit nonconforming uses of the tab character.Warn if the pointer in a pointer assignment might outlive its target.Warn if a comparison always evaluates to true or false.Warn on primary template declaration.Warn if a throw expression will always result in a call to terminate().Warn about features not present in traditional C.Warn of prototypes causing type conversions different from what would happen in the absence of prototype.Warn whenever a trampoline is generated.Warn if trigraphs are encountered that might affect the meaning of the program.Warn about unsupported features in ThreadSanitizer.Warn if a comparison is always true or always false due to the limited range of the data type.Warn about @selector()s without previously declared methods.Warn if an undefined macro is used in an #if directive.Warn about an invalid DO loop.Warn about underflow of numerical constant expressions.Warn about uninitialized automatic variables.Warn about unrecognized pragmas.Warn about unsuffixed float constants.Enable all -Wunused- warnings.Warn when a function parameter is only set, otherwise unused.Warn when a variable is only set, otherwise unused.Warn when a const variable is unused.Warn about unused dummy arguments.Warn when a function is unused.Warn when typedefs locally defined in a function are not used.Warn about macros defined in the main file that are not used.Warn when a function parameter is unused.Warn if a caller of a function, marked with attribute warn_unused_result, does not use its return value.Warn when an expression value is unused.Warn when a variable is unused.Warn about USE statements that have no ONLY qualifier.Warn about questionable usage of the macros used to retrieve variable arguments.Warn about using variadic macros.-Wvector-operation-performanceWarn when a vector operation is compiled outside the SIMD.Warn about the most vexing parse syntactic ambiguity.Warn on direct virtual inheritance.Warn if a virtual base has a non-trivial move assignment operator.Warn if a variable length array is used.-Wvla-larger-than= Warn on unbounded uses of variable-length arrays, and on bounded uses of variable-length arrays whose bound can be larger than bytes.Warn about mismatched declarations of VLA parameters.Warn about deprecated uses of volatile qualifier.Warn when a register variable is declared volatile.In C++, nonzero means warn about deprecated conversion from string literals to 'char *'. In C, similar warning, except that the conversion is of course not deprecated by the ISO C standard.-Wzero-as-null-pointer-constantWarn when a literal '0' is used as null pointer.Warn about accesses to interior zero-length array members.Warn about zero-trip DO loops.-Xf Write JSON output to the given .A synonym for -std=c89 (for C) or -std=c++98 (for C++).-aux-info Emit declaration information into .-d Enable dumps from specific passes of the compiler.Debug library to use instead of phobos.Default library to use instead of phobos.Dump only the defined symbols.Do link the standard D startup files in the compilation.-dumpbase Set the file basename to be used for dumps.-dumpbase-ext . Drop a trailing . from the dump basename to name auxiliary output files.-dumpdir Set the directory name to be used for dumps.Generate position-independent code if possible (large mode).Generate position-independent code for executables if possible (large mode).The version of the C++ ABI used for -Wabi warnings and link compatibility aliases.The version of the C++ ABI in use.Enforce class member access control semantics.-fada-spec-parent=unit Dump Ada specs as child units of given parent.-faggressive-function-eliminationEliminate multiple function invocations also for impure functions.-faggressive-loop-optimizationsAggressively optimize loops using language constraints.Enable alignment of COMMON blocks.Align labels which are only reached by jumping.Support C++17 allocation of over-aligned types.-faligned-new= Use C++17 over-aligned type allocation for alignments greater than N.Generate code for all template instantiations.All intrinsics procedures are available regardless of selected standard.Tell DCE to remove unused C++ allocations.Accept argument mismatches in procedure calls.Allow a BOZ literal constant to appear in an invalid context and with X instead of Z.-fallow-parameterless-variadic-functionsAllow variadic functions without named parameter.Allow the compiler to introduce new data races on stores.Approximate the effect of function calls to simplify analysis.Restrict the analyzer to run just the named checker.Verify that paths are feasible when emitting diagnostics.Avoid combining multiple statements into one exploded edge.-fanalyzer-show-duplicate-countIssue a note when diagnostics are deduplicated.Merge similar-enough states during analysis.Purge unneeded state during analysis.Enable transitivity of constraints during analysis.Emit more verbose descriptions of control flow in diagnostics.-fanalyzer-verbose-state-changesEmit more verbose descriptions of state changes in diagnostics.Control which events are displayed in diagnostic paths.-fasan-shadow-offset= Use custom shadow memory offset.Generate code for assert contracts.Allow optimization for floating-point arithmetic which may change the result of the operation due to rounding.Assume we are finalizing for phsa and its libhsail-rt. Enables additional phsa-specific optimizations (default).Generate unwind tables that are exact at each instruction boundary.Generate auto-inc/dec instructions.Use sample profile information for call graph node weights. The default profile file is fbdata.afdo in 'pwd'.Use sample profile information for call graph node weights. The profile file is specified in the argument.Do not treat local variables and COMMON blocks as if they were named in SAVE statements.Specify that backslash in string introduces an escape character.Produce a backtrace when a runtime error is encountered.Use bit tests for sufficiently large switch statements.-fblas-matmul-limit= Size of the smallest matrix for which matmul will use BLAS.Generate code to check bounds before indexing arrays.-fbounds-check=[on|safeonly|off] Turn array bounds checks on, in @safe code only, or off.Replace add, compare, branch with branch on count register.Use profiling information for branch probabilities.-fbranch-target-load-optimize2Generate C prototypes from BIND(C) declarations.Generate C prototypes from non-BIND(C) external procedure definitions.-fcall-saved- Mark as being preserved across functions.-fcall-used- Mark as being corrupted by function calls.Save registers around function calls.Output callgraph information on a per-file basis.Output callgraph information on a per-file basis with decorations.Where shorter, use canonicalized paths to systems headers.-fcf-protection=[full|branch|return|none|check] Instrument functions with checks to verify jump/call/return control-flow transfer instructions have valid targets.Enable the char8_t fundamental type and use it as the type for UTF-8 string and character literals.Produce a warning at runtime if a array temporary has been created for a procedure argument.This switch is deprecated; do not use.Check the return value of new in C++.-fcheck=[...] Specify which runtime checks are to be performed.Perform internal consistency checkings.-fchkp-first-field-has-own-bounds-fchkp-flexible-struct-trailing-arrays-fchkp-narrow-to-innermost-array-fchkp-treat-zero-dynamic-size-as-infinite-fchkp-use-fast-string-functions-fchkp-use-nochk-string-functions-fchkp-use-static-const-bounds-fchkp-zero-input-bounds-for-mainRemoved in GCC 8. This switch has no effect.-fcoarray= Specify which coarray parallelization should be used.Looks for opportunities to reduce stack adjustments and stack references.Put uninitialized globals in the common section.Run only the second compilation of -fcompare-debug.-fcompare-debug[=] Compile with and without e.g. -gtoggle, and compare the final-insns dump.Perform comparison elimination after register allocation has finished.Enable support for C++ concepts.Specify maximum error replay depth during recursive diagnosis of a constraint satisfaction failure.Enable certain features present in the Concepts TS.Allow the arguments of the '?' operator to have different types.Do not perform optimizations increasing noticeably stack usage.-fconst-string-class= Use class for constant strings.no class name specified with %qs-fconstexpr-cache-depth= Specify maximum constexpr recursion cache depth.-fconstexpr-depth= Specify maximum constexpr recursion depth.-fconstexpr-loop-limit= Specify maximum constexpr loop iteration count.-fconstexpr-ops-limit= Specify maximum number of constexpr operations during a single constexpr evaluation.-fconvert= The endianness used for unformatted files.Enable C++ coroutines (experimental).Perform a register copy-propagation optimization pass.Use the Cray Pointer extension.Perform cross-jumping optimization.When running CSE, follow jumps to their targets.Complex multiplication and division follow Fortran rules.Omit range reduction step when performing complex division.Ignore 'D' in column one in fixed form.Treat lines with 'D' in column one as comments.Place data items into their own section.List all available debugging counters with their limits and counts.-fdbg-cnt=[:-][:-:...][,:...] Set the debug counter limit.Use the RTL dead code elimination pass.Issue debug information for compiler-generated auxiliary variables.Emit debug annotations during preprocessing.-fdebug-prefix-map== Map one directory name to another in debug information.Output .debug_types section when using DWARF v4 debuginfo.-fdebug= Compile in debug code, code <= , or code identified by .Enable all DEC language extensions.Enable the addition of missing indexes using their lower bounds.Enable the use of blank format items in format strings.Enable the use of character literals in assignments and data statements for non-character variables.Allow varibles to be duplicated in the type specification matches.Enable default widths for i, f and g format specifiers.Enable legacy parsing of INCLUDE as statement.Enable kind-specific variants of integer intrinsic functions.Enable legacy math intrinsics for compatibility.Enable support for non-integer substring indexes.Enable support for non-logical expressions in if statements.Enable support for old style initializers in derived types.Enable support for per variable kind specification.Add support for type promotion in intrinsic arguments.Add the SEQUENCE attribute by default if it's not present.Enable DEC-style STATIC and AUTOMATIC attributes.Enable support for DEC STRUCTURE/RECORD.Factor complex constructors and destructors to favor space over speed.Set the default double precision kind to an 8 byte wide type.Set the default integer kind to an 8 byte wide type.Set the default real kind to an 10 byte wide type.Set the default real kind to an 16 byte wide type.Set the default real kind to an 8 byte wide type.Defer popping functions args from stack until later.Attempt to fill delay slots of branch instructions.Delete dead instructions that may throw exceptions.Delete useless null pointer checks.Try to convert virtual calls to direct ones.Stream extra data to support more aggressive devirtualization in LTO local transformation mode.Perform speculative devirtualization.-fdiagnostics-color=[never|always|auto] Colorize diagnostics.-fdiagnostics-column-origin= Set the number of the first column. The default is 1-based as per GNU style, but some utilities may expect 0-based, for example.-fdiagnostics-column-unit=[display|byte] Select whether column numbers are output as display columns (default) or raw bytes.-fdiagnostics-format=[text|json] Select output format.Print fix-it hints to stderr in unified diff format.-fdiagnostics-minimum-margin-width=Set minimum width of left margin of source code when showing source.-fdiagnostics-parseable-fixitsPrint fix-it hints in machine-readable form.Specify how to print any control-flow path associated with a diagnostic.Turn off any diagnostics features that complicate the output, such as line numbers, color, and warning URLs.Show the source line with a caret indicating the column.Print CWE identifiers for diagnostic messages, where available.Show labels annotating ranges of source code when showing source.-fdiagnostics-show-line-numbersShow line numbers in the left margin when showing source.-fdiagnostics-show-location=[once|every-line] How often to emit source location at the beginning of line-wrapped diagnostics.Amend appropriate diagnostic messages with the command line option that controls them.-fdiagnostics-show-path-depthsShow stack depths of events in paths.-fdiagnostics-show-template-treePrint hierarchical comparisons when template types are mismatched.-fdiagnostics-urls=[never|always|auto] Embed URLs in diagnostics.-fdisable-[tree|rtl|ipa]-=range1+range2 Disable an optimization pass.-fdoc-dir= Write documentation file to directory .-fdoc-file= Write documentation to .-fdoc-inc= Include a Ddoc macro .Allow dollar signs in entity names.Permit '$' as an identifier character.Assume that standard D runtime libraries and "D main" exist.Use the RTL dead store elimination pass.-fdump- Dump various compiler internals to a file.Write all declarations as Ada code transitively.Write all declarations as Ada code for the given file only.Dump various analyzer internals to SRCFILE.analyzer.txt.Dump analyzer-specific call graph information to a SRCFILE.callgraph.dot file.-fdump-analyzer-exploded-graphDump the analyzer exploded graph to a SRCFILE.eg.dot file.-fdump-analyzer-exploded-nodesEmit diagnostics showing the location of nodes in the exploded graph.-fdump-analyzer-exploded-nodes-2Dump a textual representation of the exploded graph to SRCFILE.eg.txt.-fdump-analyzer-exploded-nodes-3Dump a textual representation of the exploded graph to SRCFILE.eg-ID.txt.Dump various analyzer internals to SRCFILE.*.fg.dot and SRCFILE.*.tg.dot.Dump analyzer-specific data to a SRCFILE.analyzer.json.gz file.Dump state-purging information to a SRCFILE.state-purge.dot file.Dump various analyzer internals to stderr.Dump the analyzer supergraph to a SRCFILE.supergraph.dot file.Display the frontend AST after parsing and semantic passes.-fdump-final-insns=filename Dump to filename the insns at the end of translation.Display the global symbol table after parsing.Display the code tree after front end optimization.Display the code tree after parsing.-fdump-go-spec=filename Write all declarations to file as Go code.Dump detailed information on GCC's internal representation of source code locations.Suppress output of addresses in debugging dumps.Display the code tree after parsing; deprecated option.Dump Source Coverage Obligations.Suppress output of instruction numbers, line number notes and addresses in debugging dumps.Suppress output of previous and next insn numbers in debugging dumps.Enable CFI tables via GAS assembler directives.Do not elide common elements in template comparisons.-feliminate-unused-debug-symbolsPerform unused symbol elimination in debug info.-feliminate-unused-debug-typesPerform unused type elimination in debug info.Do not suppress C++ class debug information.-femit-struct-debug-baseonly Aggressive reduced debug info for structs.-femit-struct-debug-detailed= Detailed reduced debug info for structs.-femit-struct-debug-reduced Conservative reduced debug info for structs.-fenable-[tree|rtl|ipa]-=range1+range2 Enable an optimization pass.Generate code to check exception specifications.-fexcess-precision=[fast|standard] Specify handling of excess floating-point precision.-fexec-charset= Convert all strings and character constants to character set .Perform a number of minor, expensive optimizations.Interpret imaginary, fixed-point, or other gnu number suffix as the corresponding number literal rather than a user-defined number literal.Permit universal character names (\u and \U) in identifiers.Support dynamic initialization of thread-local variables in a different translation unit.Specify that an external BLAS library should be used for matmul calls on large-size arrays.Output lto objects containing both the intermediate language and binary output.-ffile-prefix-map== Map one directory name to another in compilation result.Assume that loops with an exit will terminate and not loop indefinitely.Assume no NaNs or infinities are generated.-ffixed- Mark as being unavailable to the compiler.Assume that the source file is fixed form.-ffixed-line-length- Use n as character line width in fixed mode.Allow arbitrary character line width in fixed mode.Don't allocate floats and doubles in extended-precision registers.Perform a forward propagation pass on RTL.-ffp-contract=[off|on|fast] Perform floating-point expression contraction.Allow built-in functions ceil, floor, round, trunc to raise "inexact" exceptions.-ffpe-summary=[...] Print summary of floating point exceptions.-ffpe-trap=[...] Stop on following floating point exceptions.Assume that the source file is free form.-ffree-line-length- Use n as character line width in free mode.Allow arbitrary character line width in free mode.Do not assume that standard C libraries and "main" exist.Try to interchange loops if profitable.Enable front end optimization.Allow function addresses to be held in registers.Place each function into its own section.Perform global common subexpression elimination.Perform global common subexpression elimination after register allocation has finished.Perform redundant load after store elimination in global common subexpression elimination.Perform enhanced load motion during global common subexpression elimination.Perform store motion after global common subexpression elimination.-fgnat-encodings=[all|gdb|minimal] Select the balance between GNAT encodings and standard DWARF emitted in the debug information.Recognize GNU-defined keywords.Generate code for GNU runtime environment.Enable support for GNU transactional memory.Use STB_GNU_UNIQUE if supported by the assembler.Use traditional GNU semantics for inline functions.-fgo-c-header= Write Go struct definitions to file as C code.Add explicit checks for division overflow in INT_MIN / -1.Add explicit checks for division by zero.Apply special rules for compiling runtime package.Emit debugging information related to the escape analysis pass when run with -fgo-optimize-allocs.-fgo-debug-escape-hash= Hash value to debug escape analysis.Emit optimization diagnostics.-fgo-dump- Dump Go frontend internal information.-fgo-embedcfg= List embedded files via go:embed.-fgo-optimize- Turn on optimization passes in the frontend.-fgo-pkgpath= Set Go package path.-fgo-prefix= Set package-specific prefix for exported Go names.-fgo-relative-import-path= Treat a relative import as relative to path.Enable in and out of Graphite representation.Enable Graphite Identity transformation.Enable guessing of branch probabilities.%<-fhandle-exceptions%> has been renamed %<-fexceptions%> (and is now on by default)Enable hoisting adjacent loads to encourage generating conditional move instructions.Assume normal C execution environment.Perform conversion of conditional jumps to branchless equivalents.Perform conversion of conditional jumps to conditional execution.Export functions even if they can be inlined.Emit implicit instantiations of inline templates.Specify that no implicit typing is allowed, unless overridden by explicit IMPLICIT statements.Emit implicit instantiations of templates.Do not generate .size directives.-finit-character= Initialize local character variables to ASCII value n.Initialize components of derived type variables according to other init flags.-finit-integer= Initialize local integer variables to n.Initialize local variables to zero (from g77).-finit-logical= Initialize local logical variables.-finit-real= Initialize local real variables.Enable inlining of function declared "inline", disabling disables all inlining.-finline-arg-packing Perform argument packing inline.Inline __atomic operations when a lock free instruction sequence is available.Integrate functions not declared "inline" into their callers when profitable.-finline-functions-called-onceIntegrate functions only required by their single caller.-finline-limit= Limit the size of inlined functions to .-finline-matmul-limit= Specify the size of the largest matrix for which matmul will be inlined.Integrate functions into their callers when code size is known not to grow.-finput-charset= Specify the default character set for source files.Instrument function entry and exit with profiling calls.-finstrument-functions-exclude-file-list=-finstrument-functions-exclude-file-list=filename,... Do not instrument functions listed in files.-finstrument-functions-exclude-function-list=-finstrument-functions-exclude-function-list=name,... Do not instrument listed functions.Interpret any INTEGER(4) as an INTEGER(8).Specify where to find the compiled intrinsic modules.Generate code for class invariant contracts.Perform interprocedural bitwise constant propagation.Perform interprocedural constant propagation.Perform cloning to make Interprocedural constant propagation stronger.Perform Identical Code Folding for functions and read-only variables.Perform Identical Code Folding for functions.Perform Identical Code Folding for variables.Perform interprocedural modref analysis.Perform interprocedural profile propagation.Perform interprocedural points-to analysis.Discover pure and const functions.Use caller save register across calls if possible.Discover read-only and non addressable static variables.Discover read-only, write-only and non-addressable static variables.Perform interprocedural reduction of aggregates.Reduce stack alignment on call sites if possible.Perform IPA Value Range Propagation.-fira-algorithm=[CB|priority] Set the used IRA algorithm.Use IRA based register pressure calculation in RTL hoist optimizations.Use IRA based register pressure calculation in RTL loop optimizations.-fira-region=[one|all|mixed] Set regions for IRA.Share slots for saving different hard registers.Share stack slots for spilled pseudo-registers.-fira-verbose= Control IRA's level of diagnostic messages.-fisolate-erroneous-paths-attributeDetect paths that trigger erroneous or undefined behavior due to a null value being used in a way forbidden by a returns_nonnull or nonnull attribute. Isolate those paths from the main control flow and turn the statement with erroneous or undefined behavior into a trap.-fisolate-erroneous-paths-dereferenceDetect paths that trigger erroneous or undefined behavior due to dereferencing a null pointer. Isolate those paths from the main control flow and turn the statement with erroneous or undefined behavior into a trap.-fvisibility=[private|protected|public|package] Set the default symbol visibility.Optimize induction variables on trees.Use jump tables for sufficiently large switch statements.Don't emit dllexported inline functions unless needed.Generate code for functions even if they are fully inlined.Emit static const variables even if they are not used.Generate code for static functions even if they are never called.Note #include directives translated to import declarations.-flang-info-include-translate-notNote #include directives not translated to import declarations, and not known to be textual.-flang-info-include-translate=Note a #include translation of a specific header.Note Compiled Module Interface pathnames.Note Compiled Module Interface pathname of a specific module or header-unit.Improve GCC's ability to track column numbers in large source files, at the expense of slower compilation.Allow implicit conversions between vectors with differing numbers of subparts and/or differing element types.Give external symbols a leading underscore.Tell DSE that the storage for a C++ object is dead when the constructor starts and when the destructor finishes.Set linker output type (used internally during LTO optimization).-flive-patching=[inline-only-static|inline-clone] Control IPA optimizations to provide a safe compilation for live-patching. At the same time, provides multiple-level control on the enabled IPA optimizations.Relief of register pressure through live range shrinkage.Allow access to instance variables as if they were local declarations within instance method implementations.Convert from integer to logical or logical to integer for arithmetic operations.Enable loop nest transforms. Same as -floop-nest-optimize.Enable loop interchange on trees.Enable the loop nest optimizer.Perform unroll-and-jam on loops.Do CFG-sensitive rematerialization in LRA.Enable link-time optimization.-flto-compression-level= Use zlib/zstd compression level for IL.Specify the algorithm to partition symbols and vars at linktime.Report various link-time optimization statistics.Report various link-time optimization statistics for WPA only.Link-time optimization with number of parallel jobs or jobserver.Run the link-time optimizer in local transformation (LTRANS) mode.Specify a file to which a list of files output by LTRANS is written.-fmacro-prefix-map== Map one directory name to another in __FILE__, __BASE_FILE__, and __builtin_FILE().Generate a default D main() function when compiling.Set errno after built-in math functions.-fmax-array-constructor= Maximum number of objects in an array constructor.-fmax-errors= Maximum number of errors to report.-fmax-identifier-length= Maximum identifier length.fmax-include-depth= Set the maximum depth of the nested #include.-fmax-stack-var-size= Size in bytes of the largest array that will be put on the stack.-fmax-subrecord-length= Maximum length for subrecords.Report on permanent memory allocation.Report on permanent memory allocation in WPA only.Attempt to merge identical constants and constant variables.Attempt to merge identical constants across compilation units.Attempt to merge identical debug strings across compilation units.-fmessage-length= Limit diagnostics to characters per line. 0 suppresses line-wrapping.-fmodule-file== use as source file for .Enable C++ header module (experimental).Member functions defined within their class are inline in module purview.Mapper for module to CMI files.Only emit Compiled Module Interface.Set default accessibility of module entities to PRIVATE.Generate ModuleInfo struct for output module.Enable C++ modules-ts (experimental).Perform SMS based modulo scheduling before the first scheduling pass.Perform SMS based modulo scheduling with register moves allowed.Move loop invariant computations out of loops.Don't warn about uses of Microsoft extensions.Implement C++17 inheriting constructor semantics.Implement resolution of DR 150 for matching of template template arguments.Generate code for NeXT (Apple Mac OS X) runtime environment.Assume that receivers of Objective-C messages may be nil.Support synchronous non-call exceptions.Treat a throw() exception specification as noexcept to improve code size.Specify which ABI to use for Objective-C family code and meta-data generation.Generate special Objective-C methods to initialize/destroy non-POD C++ ivars, if needed.Allow fast jumps to the message dispatcher.Enable Objective-C exception and synchronization syntax.Enable garbage collection (GC) in Objective-C/Objective-C++ programs.Enable inline checks for nil receivers with the NeXT runtime and ABI version 2.Enable Objective-C setjmp exception handling runtime.Conform to the Objective-C 1.0 language as implemented in GCC 4.0.-foffload-abi=[lp64|ilp32] Set the ABI to use in an offload compiler.-foffload== Specify offloading targets and options for them.options or targets missing after %qsWhen possible do not generate stack frames.Process all modules specified on the command line, but only generate code for the module specified by the argument.Specify default OpenACC compute dimensions.Enable OpenMP (implies -frecursive in Fortran).Enable OpenMP's SIMD directives.Recognize C++ keywords like "compl" and "xor".Enable all optimization info dumps on stderr.-fopt-info[-=filename] Dump compiler optimization details.Optimize sibling and tail recursive calls.Enable string length optimizations on trees.Try to lay out derived types as compactly as possible.Pack structure members together without holes.-fpack-struct= Set initial maximum structure member alignment.Pad shorter fixed form lines to line width with spaces.Insert NOP instructions at each function entry.Return small aggregates in memory, not registers.Look for and use PCH files even when preprocessing.Enable machine specific peephole optimizations.Enable an RTL peephole pass before sched2.Downgrade conformance errors to warnings.-fpermitted-flt-eval-methods=[c11|ts-18661] Specify which values of FLT_EVAL_METHOD are permitted.Generate position-independent code if possible (small mode).Generate position-independent code for executables if possible (small mode).Enable Plan 9 language extensions.Use PLT for PIC calls (-fno-plt: load the address from GOT at call site).-fplugin-arg--[=] Specify argument = for plugin .Report on memory allocation before interprocedural optimization.Generate code for postcondition contracts.Path to header file that should be pre-included before each compilation unit.Generate code for precondition contracts.Run predictive commoning optimization.Generate prefetch instructions, if available, for arrays in loops.Treat the input file as already preprocessed.Do not pretty-print template specializations as the template signature followed by the arguments.Treat known sprintf return values as constants.Enable basic program profiling code.Generate absolute source path names for gcov.Insert arc-based program profiling code.Enable correction of flow inconsistent profile data input.Set the top-level directory for storing the profile data. The default is 'pwd'.Instrument only functions from files whose name does not match any of the regular expressions (separated by semi-colons).Instrument only functions from files whose name matches any of the regular expressions (separated by semi-colons).Enable common options for generating profile info for profile feedback directed optimizations.Enable common options for generating profile info for profile feedback directed optimizations, and set -fprofile-dir=.Register the profile information in the .gcov_info section instead of using a constructor/destructor.Register the profile information in the specified section instead of using a constructor/destructor.Select the name for storing the profile note file.Do not assume that functions never executed during the train run are cold.Remove prefix from absolute path before mangling name for -fprofile-generate= and -fprofile-use=.Enable function reordering that improves code placement.Report on consistency of profile.-fprofile-reproducible=[serial|parallel-runs|multithreaded] Control level of reproducibility of profile gathered by -fprofile-generate.-fprofile-update=[single|atomic|prefer-atomic] Set the profile update method.Enable common options for performing profile feedback directed optimizations.Enable common options for performing profile feedback directed optimizations, and set -fprofile-dir=.Insert code to profile values of expressions.Protect parentheses in expressions.-frandom-seed= Make compile reproducible using .Enable range checking during compilation.Interpret any REAL(4) as a REAL(10).Interpret any REAL(4) as a REAL(16).Interpret any REAL(4) as a REAL(8).Interpret any REAL(8) as a REAL(10).Interpret any REAL(8) as a REAL(16).Interpret any REAL(8) as a REAL(4).Reallocate the LHS in assignments.Same as -fassociative-math for expressions which include division.Record gcc command line switches in the object file.Use a 4-byte record marker for unformatted files.Use an 8-byte record marker for unformatted files.Allocate local variables on the stack to allow indirect recursion.Turn on Redundant Extensions Elimination pass.Return small aggregates in registers.Perform a register renaming optimization pass.Reorder basic blocks to improve code placement.-freorder-blocks-algorithm=[simple|stc] Set the used basic block reordering algorithm.-freorder-blocks-and-partitionReorder basic blocks and partition into hot and cold sections.Reorder functions to improve code placement.Copy array sections into a contiguous block on procedure entry.Used in Fix-and-Continue mode to indicate that object files may be swapped in at runtime.Removed in GCC 10. This switch has no effect.Collect and dump debug information into temporary file if ICE in C/C++ compiler occurred.Functions which return values must end with return statements.Add a common subexpression elimination pass after loop optimizations.-freschedule-modulo-scheduled-loopsEnable/Disable the traditional scheduling in loops that already passed modulo scheduling.Disable optimizations that assume default FP rounding behavior.Generate run time type descriptor information.-fsanitize-address-use-after-scopeSelect type of coverage sanitization.This switch is deprecated; use -fsanitize-recover= instead.After diagnosing undefined behavior attempt to continue execution.-fsanitize-sections= Sanitize global variables in user-defined sections.-fsanitize-undefined-trap-on-errorUse trap instead of a library function for undefined behavior sanitization.Write a SRCFILE.opt-record.json file detailing what optimizations were performed.-fsched-critical-path-heuristicEnable the critical path heuristic in the scheduler.Enable the dependent count heuristic in the scheduler.Enable the group heuristic in the scheduler.Enable scheduling across basic blocks.Enable the last instruction heuristic in the scheduler.Enable register pressure sensitive insn scheduling.Enable the rank heuristic in the scheduler.Allow speculative motion of non-loads.Enable the speculative instruction heuristic in the scheduler.Allow speculative motion of some loads.Allow speculative motion of more loads.Allow premature scheduling of queued insns.Set dependence distance checking in premature scheduling of queued insns.-fsched-stalled-insns-dep= Set dependence distance checking in premature scheduling of queued insns.-fsched-stalled-insns= Set number of queued insns that can be prematurely scheduled.-fsched-verbose= Set the verbosity level of the scheduler.If scheduling post reload, do superblock scheduling.Perform a target dependent instruction fusion optimization pass.Reschedule instructions before register allocation.Reschedule instructions after register allocation.Append a second underscore if the name already contains an underscore.Access data in the same section from shared anchor points.Perform software pipelining of inner loops during selective scheduling.-fsel-sched-pipelining-outer-loopsPerform software pipelining of outer loops during selective scheduling.-fsel-sched-reschedule-pipelinedReschedule pipelined regions without pipelining.Schedule instructions using selective scheduling algorithm.Run selective scheduling after reload.Run self-tests, using the given path to locate test files.Allow interposing function (or variables) by ones with different semantics (or initializer) respectively by dynamic linker.Use the narrowest integer type possible for enumeration types.Force the underlying type for "wchar_t" to be "unsigned short".Show column numbers in diagnostics, when available. Default on.Emit function prologues only before parts of the function that need it, rather than at the top of the function.Shrink-wrap parts of the prologue and epilogue separately.Apply negative sign to zero values.Disable optimizations observable by IEEE signaling NaNs.When "signed" or "unsigned" is not given make the bitfield signed.Make "char" signed by default.Disable floating point optimizations that ignore the IEEE signedness of zero.-fsimd-cost-model=[unlimited|dynamic|cheap|very-cheap] Specifies the vectorization cost model for code marked with a simd directive.Convert floating point constants to single precision constants.Enable C++14 sized deallocation support.Split lifetimes of induction variables when loops are unrolled.Split paths leading to loop backedges.Generate discontiguous stack frames.Split wide types into independent registers.Split wide types into independent registers earlier.Enable backward propagation of use properties at the SSA level.Optimize conditional patterns using SSA PHI nodes.-fsso-struct=[big-endian|little-endian|native] Set the default scalar storage order.Put all local arrays on stack.Insert stack checking code into the program. Same as -fstack-check=specific.-fstack-check=[no|generic|specific] Insert stack checking code into the program.Insert code to probe each page of stack space as it is allocated to protect from stack-clash style attacks.-fstack-limit-register= Trap if the stack goes past .-fstack-limit-symbol= Trap if the stack goes past symbol .Use propolice as a stack protection method.Use a stack protection method for every function.Use stack protection method only for functions with the stack_protect attribute.Use a smart stack protection method for certain functions.-fstack-reuse=[all|named_vars|none] Set stack reuse level for local variables.Output stack usage information on a per-function basis.Display statistics accumulated during compilation.Optimize amount of stdarg registers saved to stack at start of function.Assume strict aliasing rules apply.Assume that values of enumeration type are always within the minimum range of that type.Treat signed overflow as undefined. Negated as -fwrapv -fwrapv-pointer.Force bitfield accesses to match their type width.Follow the C++17 evaluation order requirements for assignment expressions, shift, member function calls, etc.Generate code for switches without a default case.Implement __atomic operations via libcalls to legacy __sync functions.Check for syntax errors, then stop.-ftabstop= Distance between tab stops for column reporting.Disallow tail call optimization when a calling routine may have omitted character lengths.Set the maximum number of template instantiation notes for a single warning or error.-ftemplate-depth= Specify maximum template instantiation depth.Create data files needed by "gcov".Force creation of temporary to test infrequently-executed forall code.Perform jump threading optimizations.-fno-threadsafe-statics Do not generate thread-safe code for initializing local statics.Report the time taken by each compiler pass.Record times taken by sub-phases separately.-ftls-model=[global-dynamic|local-dynamic|initial-exec|local-exec] Set the default thread-local storage code generation model.Reorder top level functions, variables, and asms.Perform superblock formation via tail duplication.-ftrack-macro-expansion=<0|1|2> Track locations of tokens coming from macro expansion and display them in error messages.For targets that normally need trampolines for nested functions, always generate them instead of using descriptors.List information on all language changes.List all usages of complex or imaginary types.Implement DIP1000: Scoped pointers (experimental).Implement DIP25: Sealed references (experimental).List all non-mutable fields which occupy an object instance.List all hidden GC allocations.List all variables going into thread local storage.Assume floating-point operations can trap.Trap for signed overflow in addition, subtraction and multiplication.Enable SSA-BIT-CCP optimization on trees.Enable conditional dead code elimination for builtin calls.Enable SSA-CCP optimization on trees.Enable loop header copying on trees.Enable SSA coalescing of user variables.Enable copy propagation on trees.Transform condition stores into unconditional ones.Enable SSA dead code elimination optimization on trees.Enable dominator optimizations.Enable dead store elimination.Enable forward propagation on trees.Enable Full Redundancy Elimination (FRE) on trees.-ftree-loop-distribute-patternsEnable loop distribution for patterns transformed into a library call.Enable loop distribution on trees.Convert conditional jumps in innermost loops to branchless equivalents.Enable loop invariant motion on trees.Create canonical induction variables in loops.Enable loop optimizations on tree level.Enable loop vectorization on trees.Perform live range splitting during the SSA->normal pass.-ftree-parallelize-loops= Enable automatic parallelization of loops.In SSA-PRE optimization on trees, enable partial-partial redundancy elimination.Enable hoisting loads from conditional pointers.Enable SSA-PRE optimization on trees.Perform function-local points-to analysis on trees.Enable reassociation on tree level.Enable copy propagation of scalar-evolution information.Enable SSA code sinking on trees.Enable basic block vectorization (SLP) on trees.Perform straight-line strength reduction.Perform scalar replacement of aggregates.Perform conversions of switch initializations.Replace temporary expressions in the SSA->normal pass.Enable vectorization on trees.Perform Value Range Propagation on trees.Assume common declarations may be overridden with ones with a larger trailing array.Append underscores to externally visible names.Compile whole compilation unit at a time.Perform loop unrolling for all loops.Perform loop unrolling when iteration count is known.Allow math optimizations that may violate IEEE or ISO standards.When "signed" or "unsigned" is not given make the bitfield unsigned.Make "char" unsigned by default.Just generate unwind tables for exception handling.Use __cxa_atexit to register destructors.Use __cxa_get_exception_ptr in exception handling.Use the bfd linker instead of the default linker.Use the gold linker instead of the default linker.Use the lld LLVM linker instead of the default linker.Perform variable tracking by annotating assignments.-fvar-tracking-assignments-toggleToggle -fvar-tracking-assignments.Perform variable tracking and also tag variables that are uninitialized.-fvariable-expansion-in-unrollerApply variable expansion when loops are unrolled.Enables the dynamic vectorizer cost model. Preserved for backward compatibility.-fvect-cost-model=[unlimited|dynamic|cheap|very-cheap] Specifies the cost model for vectorization.Add extra commentary to assembler output.Version loops based on whether indices have a stride of one.-fversion= Compile in version code >= or identified by .Marks all inlined functions and methods as having hidden visibility.Changes visibility to match Microsoft Visual Studio by default.-fvisibility=[default|internal|hidden|protected] Set the default symbol visibility.Use expression value profiles in optimizations.Validate vtable pointers before using them.Output vtable verification counters.Output vtable verification pointer sets information.Emit common-like symbols as weak symbols.Emit template instantiations as weak symbols.Construct webs and split unrelated uses of single variable.Perform whole program optimizations.-fwide-exec-charset= Convert all wide strings and character constants to character set .Generate a #line directive pointing at the current working directory.Run the link-time optimizer in whole program analysis (WPA) mode.Whole program analysis (WPA) mode with number of parallel jobs specified.Assume signed arithmetic overflow wraps around.Assume pointer overflow wraps around.Clear call-used registers upon function return.Put zero initialized data in the bss section.Generate lazy class lookup (via objc_getClass()) for use in Zero-Link mode.Generate debug information in default format.Assume assembler support for (DWARF2+) .loc directives.Assume assembler support for view in (DWARF2+) .loc directives.Record DW_AT_decl_column and DW_AT_call_column in DWARF.Add description attributes to some DWARF DIEs that have no name attribute.Generate debug information in default version of DWARF format.Generate debug information in DWARF v2 (or later) format.Use 32-bit DWARF format when emitting DWARF debug information.Use 64-bit DWARF format when emitting DWARF debug information.Dump declarations to a .decl file.Generate debug information in default extended format.Generate DWARF pubnames and pubtypes sections with GNU extensions.Dump the statistics of gimple statements.Generate extended entry point information for inlined functions.-ginternal-reset-location-viewsCompute locview reset points based on insn length estimates.-gnat Specify options to GNAT.Set name of output ALI file (internal switch).Don't generate DWARF pubnames and pubtypes sections.Generate DWARF pubnames and pubtypes sections.Record gcc command line switches in DWARF DW_AT_producer.Generate debug information in separate .dwo files.Generate debug information in STABS format.Generate debug information in extended STABS format.Emit progressive recommended breakpoint locations.Don't emit DWARF additions beyond selected version.Toggle debug information generation.Augment variable location lists with progressive views.-gvariable-location-views=incompat5Generate debug information in VMS format.Generate debug information in XCOFF format.Generate debug information in extended XCOFF format.Generate compressed debug sections.-gz= Generate compressed debug sections in format .Dump the dump tool command line options.-idirafter Add to the end of the system include path.-imacros Accept definition of macros in .-imultiarch Set to be the multiarch include subdirectory.-imultilib Set to be the multilib include subdirectory.-include Include the contents of before other files.-iplugindir= Set to be the default plugin directory.-iprefix Specify as a prefix for next two options.-iquote Add to the end of the quote include path.-isysroot Set to be the system root directory.-isystem Add to the start of the system include path.-iwithprefix Add to the end of the system include path.-iwithprefixbefore Add to the end of the main include path.Call the dump function for variables and function in IL.Support 3DNow! built-in functions.Support Athlon 3Dnow! built-in functions.Expand 32bit/64bit integer divide into 8bit unsigned integer divide with run-time check.Generate code that conforms to the given ABI.Support code generation of Advanced Bit Manipulation (ABM) instructions.Reserve space for outgoing arguments in the function prologue.Support flag-preserving add-carry instructions.Support AES built-in functions and code generation.Align some doubles on dword boundary.Function starts are aligned to this power of 2.Jump targets are aligned to this power of 2.Loop code aligned to this power of 2.Align destination of the string operations.Support AMX-BF16 built-in functions and code generation.Support AMX-INT8 built-in functions and code generation.Support AMX-TILE built-in functions and code generation.Generate code for the Android platform.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2 and AVX built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX and AVX2 built-in functions and code generation.Split 32-byte AVX unaligned load.-mavx256-split-unaligned-storeSplit 32-byte AVX unaligned store.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2, AVX512F and AVX5124FMAPS built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2, AVX512F and AVX5124VNNIW built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2, AVX512F and AVX512BF16 built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2, AVX512F and AVX512BITALG built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2 and AVX512F and AVX512BW built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2 and AVX512F and AVX512CD built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2 and AVX512F and AVX512DQ built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2 and AVX512F and AVX512ER built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2 and AVX512F built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2 and AVX512F and AVX512IFMA built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2 and AVX512F and AVX512PF built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2 and AVX512F and AVX512VBMI built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2, AVX512F and AVX512VBMI2 built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2 and AVX512F and AVX512VL built-in functions and code generation.Support AVX512VNNI built-in functions and code generation.Support AVX512VP2INTERSECT built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2, AVX512F and AVX512VPOPCNTDQ built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX, AVX2, and AVXVNNI built-in functions and code generation.Support BMI built-in functions and code generation.Support BMI2 built-in functions and code generation.Branches are this expensive (arbitrary units).Use libgcc stubs to save and restore registers clobbered by 64-bit Microsoft to System V ABI calls.Turn on CET instrumentation for switch statements that use a jump table and an indirect jump.Generate cld instruction in the function prologue.Support CLDEMOTE built-in functions and code generation.Support CLFLUSHOPT instructions.Support CLZERO built-in functions and code generation.%<-mcpu=%> is deprecated; use %<-mtune=%> or %<-march=%> insteadSupport code generation of crc32 instruction.Support code generation of cmpxchg16b instruction.Do dispatch scheduling if processor is bdver1, bdver2, bdver3, bdver4 or znver1 and Haifa scheduling is selected.Support ENQCMD built-in functions and code generation.Support F16C built-in functions and code generation.Generate sin, cos, sqrt for FPU.Emit profiling counter call at function entry before prologue.Set name of __fentry__ symbol called at function entry.Set name of section to record mrecord-mcount calls.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, AVX and FMA built-in functions and code generation.Support FMA4 built-in functions and code generation.Always use Dynamic Realigned Argument Pointer (DRAP) to realign stack.Make all function calls indirect.Return values of functions in FPU registers.Generate floating point mathematics using given instruction set.Support FSGSBASE built-in functions and code generation.Convert function return to call and return thunk.%<-mfused-madd%> is deprecated; use %<-ffp-contract=%> insteadSupport FXSAVE and FXRSTOR instructions.Enable vectorization for gather instruction.Generate code which uses only the general registers.Support GFNI built-in functions and code generation.Generate code to mitigate against straight line speculation.Support Hardware Lock Elision prefixes.Support HRESET built-in functions and code generation.Generate code that conforms to Intel MCU psABI.Use IEEE math for fp comparisons.Assume incoming stack aligned to this power of 2.Add CS prefix to call and jmp to indirect thunk with branch target in r8-r15 registers.Force indirect call and jump via register.Convert indirect call and jump to call and return thunks.Inline all known string operations.-minline-stringops-dynamicallyInline memset/memcpy string operations, but perform inline version only for small blocks.Instrument function exit in instrumented functions with __fentry__.%<-mintel-syntax%> and %<-mno-intel-syntax%> are deprecated; use %<-masm=intel%> and %<-masm=att%> insteadSupport KL built-in functions and code generation.-mlarge-data-threshold= Data greater than given threshold will go into .ldata section in x86-64 medium model.Support LWP built-in functions and code generation.Support LZCNT built-in function and code generation.Insert ENDBR instruction at function entry only via cf_check attribute for CET instrumentation.Specify memcpy expansion strategy when expected size is known.Specify memset expansion strategy when expected size is known.Support MMX built-in functions.Support code generation of movbe instruction.Support MOVDIR64B built-in functions and code generation.Support MOVDIRI built-in functions and code generation.Use native (MS) bitfield layout.Support MWAIT and MONITOR built-in functions and code generation.Support MWAITX and MONITORX built-in functions and code generation.Emit GNU_PROPERTY_X86_ISA_1_NEEDED GNU property.Do not support SSE4.1 and SSE4.2 built-in functions and code generation.Generate mcount/__fentry__ calls as nops. To activate they need to be patched in.Omit the frame pointer in leaf functions.Set 80387 floating-point precision to 32-bit.Set 80387 floating-point precision to 64-bit.Set 80387 floating-point precision to 80-bit.Support PCLMUL built-in functions and code generation.Support PCONFIG built-in functions and code generation.Support PKU built-in functions and code generation.Support code generation of popcnt instruction.Use 128-bit AVX instructions instead of 256-bit AVX instructions in the auto-vectorizer.Use given register vector width instructions instead of maximum register width in the auto-vectorizer.Attempt to keep stack aligned to this power of 2.Support PREFETCHWT1 built-in functions and code generation.Support PREFETCHW instruction.Support PTWRITE built-in functions and code generation.Use push instructions to save outgoing arguments.Support RDPID built-in functions and code generation.Support RDRND built-in functions and code generation.Generate reciprocals instead of divss and sqrtss.Control generation of reciprocal estimates.Generate __mcount_loc section with all mcount or __fentry__ calls.Generate a __return_loc section pointing to all return instrumentation code.Use red-zone in the x86-64 code.Number of registers used to pass integer arguments.Support RTM built-in functions and code generation.Support code generation of sahf instruction in 64bit x86-64 code.Support SERIALIZE built-in functions and code generation.Support SGX built-in functions and code generation.Support SHA1 and SHA256 built-in functions and code generation.Enable shadow stack built-in functions from Control-flow Enforcement Technology (CET).Skip setting up RAX register when passing variable arguments.Support MMX and SSE built-in functions and code generation.Support MMX, SSE and SSE2 built-in functions and code generation.Encode SSE instructions with VEX prefix.Support MMX, SSE, SSE2 and SSE3 built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1 and SSE4.2 built-in functions and code generation.Support MMX, SSE, SSE2, SSE3, SSSE3 and SSE4.1 built-in functions and code generation.Support MMX, SSE, SSE2, SSE3 and SSE4A built-in functions and code generation.Use SSE register passing conventions for SF and DF mode.Support MMX, SSE, SSE2, SSE3 and SSSE3 built-in functions and code generation.-mstack-protector-guard-offset=Use the given offset for addressing the stack-protector guard.Use the given base register for addressing the stack-protector guard.-mstack-protector-guard-symbol=Use the given symbol for addressing the stack-protector guard.Use given stack-protector guard.Chose strategy to generate stringop using.Disable Scalar to Vector optimization pass transforming 64-bit integer computations into a vector ones.Support TBM built-in functions and code generation.Use given thread-local storage dialect.Use direct references against %gs when accessing tls data.Support TSXLDTRK built-in functions and code generation.Fine grain control of tune features.Support UINTR built-in functions and code generation.Support VAES built-in functions and code generation.Return 8-byte vectors in memory.Support VPCLMULQDQ built-in functions and code generation.Generate vzeroupper instruction before a transfer of control flow out of the function.Support WAITPKG built-in functions and code generation.Support WBNOINVD built-in functions and code generation.Support WIDEKL built-in functions and code generation.Support XOP built-in functions and code generation.Support XSAVE and XRSTOR instructions.Support XSAVES and XRSTORS instructions.Sort the symbols alphabetically.Don't create a dynamically linked position independent executable.Do not link the standard D library in the compilation.Do not search standard system include directories (those specified with -isystem will still be used).Do not search standard system include directories for C++.Do not look for object files in standard path.-o Place output into .Dump the details of LTO objects.Like -pedantic but issue them as errors.Create a dynamically linked position independent executable.Generate C header of platform-specific features.Print the initial values of the variables.Do not display functions compiled or elapsed time.Remap file names when including files.Display the symbols in reverse order.Link the standard D library dynamically in the compilation.Sort the symbols according to size.Statically link the GNU Fortran helper library (libgfortran).Link the standard D library statically in the compilation.Create a static position independent executable.Conform to the ISO 1998 C++ standard revised by the 2003 technical corrigendum.Deprecated in favor of -std=c++11.Conform to the ISO 2011 C++ standard.Conform to the ISO 2014 C++ standard.Conform to the ISO 2017 C++ standard.Deprecated in favor of -std=c++14.Deprecated in favor of -std=c++17.Conform to the ISO 2020 C++ standard (experimental and incomplete support).Conform to the ISO 2023 C++ draft standard (experimental and incomplete support).Conform to the ISO 2011 C standard.Conform to the ISO 2017 C standard (published in 2018).Deprecated in favor of -std=c11.Conform to the ISO 202X C standard draft (experimental and incomplete support).Conform to the ISO 1990 C standard.Conform to the ISO 1999 C standard.Deprecated in favor of -std=c99.Conform to the ISO Fortran 2003 standard.Conform to the ISO Fortran 2008 standard.Conform to the ISO Fortran 2008 standard including TS 29113.Conform to the ISO Fortran 2018 standard.Conform to the ISO Fortran 95 standard.Conform to nothing in particular.Conform to the ISO 1998 C++ standard revised by the 2003 technical corrigendum with GNU extensions.Deprecated in favor of -std=gnu++11.Conform to the ISO 2011 C++ standard with GNU extensions.Conform to the ISO 2014 C++ standard with GNU extensions.Conform to the ISO 2017 C++ standard with GNU extensions.Deprecated in favor of -std=gnu++14.Deprecated in favor of -std=gnu++17.Conform to the ISO 2020 C++ standard with GNU extensions (experimental and incomplete support).Conform to the ISO 2023 C++ draft standard with GNU extensions (experimental and incomplete support).Conform to the ISO 2011 C standard with GNU extensions.Conform to the ISO 2017 C standard (published in 2018) with GNU extensions.Deprecated in favor of -std=gnu11.Conform to the ISO 202X C standard draft with GNU extensions (experimental and incomplete support).Conform to the ISO 1990 C standard with GNU extensions.Conform to the ISO 1999 C standard with GNU extensions.Deprecated in favor of -std=gnu99.Conform to the ISO 1990 C standard as amended in 1994.Deprecated in favor of -std=iso9899:1999.Accept extensions to support legacy code.-stdlib=[libstdc++|libc++] The standard library to be used for C++ headers and runtime.Enable traditional preprocessing.-trigraphs Support ISO C trigraphs.Dump the statistics of tree types.Do not predefine system-specific and GCC-specific macros.Display the compiler's version.iBiF  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/tmp/usr/tmp/var/tmpL0d0CBBBBQ00000000000000000000000000000000%I$ <;G]tB{= 0$~`2fCOmA oE!a  0P AA ?  &*"@ `0PHX? "A!)?linemap_compare_locations../../libcpp/line-map.c [CWE-%iget_or_insert_file../../gcc/edit-context.capply_fixitpp_format../../gcc/pretty-print.cqwl+#%lld%lo%llo%p%u%llu%f%#lx%x%lx%llxone_based:%d:%d, locus%s%s %r%s%s%Rdiagnostic_build_prefix../../gcc/diagnostic.c%s %s%s%slinemap_expand_location%s%s%s:%spp_output_formatted_textrange1range2fixit-insertfixit-deletemaybe_add_location_rangecalculate_line_spansline_spancalculate_linenum_widthprint_gap_in_line_numberingget_expanded_locationprint_leading_fixits%i | cpp_display_width_computation../../libcpp/charset.cprint_source_lineintersects_line_pprint_any_labelsadd_hintsubspan../../gcc/input.hensure_terminatedSee %s for instructions. compilation terminated. fatal_error\x%02xconvert_column_unitELF object format mismatchELF machine number mismatchundocumented error #%dtotal_lines_num../../gcc/input.cread_line_numget_next_linenum_digitsbegin_statecontains_point |debug pathshort write.shstrtabcolumn_range???0x%lx %s %s:%d %s%s%s internal compiler error: in %s, at %s:%dcalculate_allocation_1../../gcc/vec.coverwriteprint_escaped_string\\\t\n\"\%o%o%oprint_parseable_fixitsfix-it::{%i:%i-%i:%i}:deleting LTRANS file %s: %m[Leaving LTRANS %s] , core dumpedcannot get program status: %m%s returned %d exit status/mkoffloadOFFLOAD_TARGET_DEFAULT.target.ooffload_argstoplev::mainexecute_one_passcompile_file fromIn file included from included fromIn moduleof moduleIn module imported atfatal error: sorry, unimplemented: warning: anachronism: note: debug: path: pedwarn: permerror: must-not-happennotediff-filenamediff-hunkdiff-deletediff-inserttype-diffInternal compiler error: Error reporting routines re-entered. compilation terminated due to -fmax-errors=%u. %s:%d: confused by earlier errors, bailing out https://cwe.mitre.org/data/definitions/%i.html../../gcc/diagnostic-event-id.h../../gcc/diagnostic-show-locus.ccompilation terminated due to -Wfatal-errors. Please submit a full bug report, with preprocessed source if appropriate. Please include the complete backtrace with any bug report. diagnostic_action_after_output%s: all warnings being treated as errors%s: some warnings being treated as errorsget_line_bytes_without_trailing_whitespace%s terminated with signal %d [%s]%scould not find %s in %s (consider using %<-B%>)^¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯#¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯¯ӎ¯¯¯¯¯¯¯¯I!¯ ¯¯¯͔¯¯....y../../gcc/diagnostic.coJ_op/J#$'(-X[ 9 : ; < @ H L M P W a c  ; < @ B F H J M P Q o q t u  ; < > ? @ D L M T V a c   = @ E H I M T V a c  : < @ D L M a c 013:FN456789p~,0178:<>WY]`pt_\_14QSqs "&(128;UVW^_`abdlr|~345:;<ABjs+357  ) . _ d e o ##(#*#######%%&&G&S&~&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '''('K'L'M'N'R'U'V'W'''''''++O+P+T+U+,,~----.....////)0-0>0@000001/101111122Ƥnrs} $&+,èŨߨ%-FQ_|(.0246BCKL{|mo/RSfgk`uz      7 : > ?   # ' EP7F~&+,4rs.13457=>:<?@elot7?ADEF]^2:<=>@!%&+.78::<=>BC 28:>FGPVX[/67=>?069:;=>EFG/484jj/k6kNoOoooooooooՌORcgofirAD6:ltu!"$%*/6CJ;?HOQ_e ,56|}>?@A=JNOgyzO :;EFxyotwzݦ4?Jno debug info in ELF executableno symbol table in ELF executableDW_FORM_addrx value out of rangesigned LEB128 overflows uint64_tDW_FORM_strx value out of rangeDW_FORM_strx offset out of rangernglists index offset out of rangeDW_FORM_line_strp out of rangeDW_FORM_indirect to DW_FORM_implicit_constabstract origin or specification out of rangeinvalid abstract origin or specificationinvalid directory index in line number program headermissing file name in line number program headerexecutable file is unrecognized ELF versionexecutable file is unexpected ELF classexecutable file has unknown endiannessELF symbol table strtab link out of rangesymbol string index out of rangefailed to read executable informationlibbacktrace could not find executable to openinvalid file number in DW_AT_call_file attributeunsupported line number versionnon-zero segment_selector_size not supportedinvalid directory index in line number programinvalid file number in line number program%s in %s at %dDWARF underflowunrecognized address size.debug_addrLEB128 overflows uint64_t.debug_str_offsetsranges offset out of range.debug_rangesrnglists offset out of range.debug_rnglistsunrecognized DW_RLE valueinvalid abbreviation codeDW_FORM_strp out of rangeDW_FORM_strp_sup out of rangeunrecognized DWARF form]8;;pp_begin_urlmmap.debug//usr/lib/debug/executable file is not ELF.note.gnu.build-idGNU.gnu_debuglink.gnu_debugaltlink.gnu_debugdata.opd/usr/lib/debug/.build-id/fstatunrecognized DWARF versionabbrev offset out of range.debug_abbrev/proc/curproc/file/proc/self/exe/proc/%ld/object/a.outunit line offset out of range.debug_line.debug_str.debug_line_strY[~wXGfqKdB^n7&-7AJ7zXZ5T55,5555HH)I?IIFFIIFFITQMQ;Q~Q;QTQTQGQMQIVIVIVIVIVIVIVIVIVIVUUUUUUUZVUXsYU8VXUUUUUVIV:XdXUXWU Y!Y6U6U6U6U6U6U6U6U6U6U6U6UY6UYYZY6UZ+Z6U6U6U6UE[6UY6U6U"Z!YZZ1___`!_)_kkzlwlwlwlkwlwlklwlwlwlwlwlklknqopooqo@qp)qoooooooopoooWq                                         P p00 ` @P X x8@ h( H` T t48 d$DX \ |<H l,( Lh R r24 b"BT Z z:D j*$ Jd V v6< f&F\ ^  ~>L n.,Nl Q q12 a!AR Y y9B i)" Ib U u5: e%EZ ]  }=J m-* Mj S s36 c#CV [ {;F k+& Kf W w7> g'G^ _ ?N o/.Onqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqrrrrrqrrr(}3t8.uJؿf"""5oORRss-p~-V~t~~wD<L~\/4joQey "0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-Mach-O object format mismatchXCOFF object format mismatchmemory exhausted.rela.rel.gnu.debuglto_.gnu.lto_.debug_.note.GNU-stack.note.gnu.property.comment.GCC.command.lineToo many copied sections.go_export/%lu__wrapper_names__wrapper_index__wrapper_sects__section_names%08lXmunmapinternal_error]8;;\]8;;get_end_url_stringix86_excess_precisionrecip_maskix86_isa_flags2_explicitix86_isa_flags_explicitdump_base_name_prefixedexit_after_optionsflag_dump_all_passedflag_opts_finishedflag_stack_usage_infoflag_warn_unused_resultin_lto_puse_gnu_debug_info_extensionshelp_enum_printedhelp_printedaux_base_namemain_input_basenamemain_input_filenamedebug_info_levelwrite_symbolsdebug_struct_genericdebug_struct_ordinaryflag_incremental_linkflag_stack_checkflag_complex_methodflag_debug_asmflag_dump_rtl_in_asmflag_gen_aux_infoflag_generate_ltoflag_generate_offloadflag_print_asm_nameflag_shlibmain_input_baselengthoptimize_debugoptimize_fastoptimize_sizerecip_mask_explicitrtl_dump_and_exittarget_flagsflag_sanitizeflag_sanitize_coverageflag_sanitize_recoverflag_zero_call_used_regshelp_columnsinitial_max_fld_alignsection string index out of rangeWrong section type of a SYMTAB SECTION INDICES sectionGNU Mach-o section wrapper: required section missingsection name offset out of range %s%sout of memory allocating %lu bytes after a total of %lu bytes out of range for in-memory fileix86_stack_protector_guard_offsetix86_stack_protector_guard_regix86_unsafe_math_optimizationsflag_instrument_functions_exclude_filesflag_instrument_functions_exclude_functionsN9__gnu_cxx20recursive_init_errorEN10__cxxabiv120__si_class_type_infoESt9type_info0123456789not enough space for format expansion (Please submit full bug report at https://gcc.gnu.org/bugsstd::bad_allocSt9bad_allocstd::bad_array_new_lengthSt20bad_array_new_lengthstd::bad_castSt8bad_caststd::bad_typeidSt10bad_typeidN10__cxxabiv117__class_type_infoE__gnu_cxx::__concurrence_lock_error__gnu_cxx::__concurrence_unlock_errorN9__gnu_cxx24__concurrence_lock_errorEN9__gnu_cxx26__concurrence_unlock_errorEstd::exceptionstd::bad_exceptionSt9exceptionSt13bad_exceptionN10__cxxabiv115__forced_unwindEN10__cxxabiv119__foreign_exceptionE\\$\terminate called recursively ' what(): terminate called after throwing an instance of 'terminate called without an active exception basic_string::_S_createSt11logic_errorSt12domain_errorSt16invalid_argumentSt12length_errorSt12out_of_rangeSt13runtime_errorSt11range_errorSt14overflow_errorSt15underflow_errorbasic_string::_S_construct null not valid%s:%d: %s: Assertion '%s' failed. %s: __pos (which is %zu) > this->size() (which is %zu)__pos <= size()const value_type& std::basic_string<_CharT, _Traits, _Alloc>::operator[](std::basic_string<_CharT, _Traits, _Alloc>::size_type) const [with _CharT = char; _Traits = std::char_traits; _Alloc = std::allocator; std::basic_string<_CharT, _Traits, _Alloc>::const_reference = const char&; std::basic_string<_CharT, _Traits, _Alloc>::size_type = long unsigned int]/builddir/build/BUILD/gcc-11.5.0-20240719/obj-x86_64-redhat-linux/x86_64-redhat-linux/libstdc++-v3/include/bits/basic_string.hbasic_string::at: __n (which is %zu) >= this->size() (which is %zu)!empty()const value_type& std::basic_string<_CharT, _Traits, _Alloc>::front() const [with _CharT = char; _Traits = std::char_traits; _Alloc = std::allocator; std::basic_string<_CharT, _Traits, _Alloc>::const_reference = const char&]const value_type& std::basic_string<_CharT, _Traits, _Alloc>::back() const [with _CharT = char; _Traits = std::char_traits; _Alloc = std::allocator; std::basic_string<_CharT, _Traits, _Alloc>::const_reference = const char&]basic_string::copybasic_string::comparestd::basic_string<_CharT, _Traits, _Alloc>::value_type& std::basic_string<_CharT, _Traits, _Alloc>::operator[](std::basic_string<_CharT, _Traits, _Alloc>::size_type) [with _CharT = char; _Traits = std::char_traits; _Alloc = std::allocator; std::basic_string<_CharT, _Traits, _Alloc>::reference = char&; std::basic_string<_CharT, _Traits, _Alloc>::size_type = long unsigned int]std::basic_string<_CharT, _Traits, _Alloc>::value_type& std::basic_string<_CharT, _Traits, _Alloc>::front() [with _CharT = char; _Traits = std::char_traits; _Alloc = std::allocator; std::basic_string<_CharT, _Traits, _Alloc>::reference = char&]std::basic_string<_CharT, _Traits, _Alloc>::value_type& std::basic_string<_CharT, _Traits, _Alloc>::back() [with _CharT = char; _Traits = std::char_traits; _Alloc = std::allocator; std::basic_string<_CharT, _Traits, _Alloc>::reference = char&]basic_string::erasebasic_string::_M_replace_auxbasic_string::insertbasic_string::replacebasic_string::assignvoid std::basic_string<_CharT, _Traits, _Alloc>::pop_back() [with _CharT = char; _Traits = std::char_traits; _Alloc = std::allocator]basic_string::appendbasic_string::resizebasic_string::basic_stringbasic_string::substr?random_device: rdrand failedrandom_device: rdseed failedbasic_string::_M_construct null not validbasic_string::_M_create/dev/urandomrdrand/dev/randomrandom_device::random_device(const std::string&): unsupported tokenrandom_device::random_device(const std::string&): device not availablemt19937random_device could not be read@@std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::const_reference std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::operator[](std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::size_type) const [with _CharT = char; _Traits = std::char_traits; _Alloc = std::allocator; std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::const_reference = const char&; std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::size_type = long unsigned int]std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::reference std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::operator[](std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::size_type) [with _CharT = char; _Traits = std::char_traits; _Alloc = std::allocator; std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::reference = char&; std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::size_type = long unsigned int]std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::reference std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::front() [with _CharT = char; _Traits = std::char_traits; _Alloc = std::allocator; std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::reference = char&]std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::const_reference std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::front() const [with _CharT = char; _Traits = std::char_traits; _Alloc = std::allocator; std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::const_reference = const char&]std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::reference std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::back() [with _CharT = char; _Traits = std::char_traits; _Alloc = std::allocator; std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::reference = char&]std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::const_reference std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::back() const [with _CharT = char; _Traits = std::char_traits; _Alloc = std::allocator; std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::const_reference = const char&]void std::__cxx11::basic_string<_CharT, _Traits, _Alloc>::pop_back() [with _CharT = char; _Traits = std::char_traits; _Alloc = std::allocator]basic_string::_M_replacestring::stringC$DDCDCC~C$DFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFGGFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFI(clqu : new falsetruejava resource decltype (this{parm#global constructors keyed to global destructors keyed to {lambda()#{unnamed type# [clone restrict volatile const transaction_safe noexcept throw&& _Complex _Imaginary::* __vector(_GLOBAL_(......) ... std::allocatorstd::basic_stringstd::stringstd::istreambasic_istreamstd::ostreambasic_ostreamstd::iostreambasic_iostreamaN&=aSaaalignof awco_await azconst_castcmco~dV/=dX[...]=dadelete[] dcdynamic_castdidldelete .*dtdveO^=eo^eq==fLfRflfrgtlS<<=lioperator"" <<mI-=mL*=mm--nanew[]!=!nwoR|=oo||pL+=plpm->*->rM%=rS>>=rcreinterpret_cast%>>sPsizeof...sZscstatic_cast<=>sizeof sztwthrow booleanlong double__float128unsigned charunsigned intunsignedunsigned longunsigned __int128unsigned shortvoidwchar_tunsigned long longdecimal32decimal64decimal128halfchar16_tchar32_ttemplate parameter object for std::basic_string, std::allocator >std::basic_istream >std::basic_ostream >std::basic_iostream >4D$x8xXlllllllllllllllllllllllllllllllld\'1>KXbt],Ll HvCvD )[!!!!!!!!!!!!!!!!!!!!!!yl<hxNNNN;*OT*$*t++VT,e, -t--A8.t.8//]0P00G0Rh11H22Z2<33444\55;4667`7x 7 `8>!8H!8T!L9!9!9!<:("|:2":d"(;q";";"(<"\<"=1/=i@>@4>AD>eD0?Dt?E?F0@G@G@GAuGhAGAGPBjWB|WBW@CtXCXCXDXpD8YD1Z,EtZ F[dF[F\G\TG\\Ge\@H\H] I]dIM^If^J_K``L`lL!aLxatMaMaMa\NbNvb(ObXObObOcDP*c`P&dPdQeXRiRj`SjSjTj,TjhT k|TkTRkT[kTbkTikUpkUwk0U~kXUklUkUkUkUkUkUkUkUk Vk Vk4VkHVk\VkpVkVkVkVkVlV lVlWl8Wl`W&lW-lW4lW;lXBl(XIlPXPlxXWlX^lXelXllYsl@YzlhYl|YlYlYlYlZlZlDZllZlZlZlZlZl [lH[lp[l[l[l[l[m[ m\m8\m`\"mt\)m\0m\7m\m\m\$o(]tpd]p]q]q]@q]r4^sP^as|^t^t^du_u_v4_IvL_ w_Hw_Sx`yP`<{`{`|`}a/}4av`aa8a̅a߅bb 0b"DbbXbxlbbІbb(c$p|>|>|@|$@|/@}B\}Bx}C}>Q}~Q}Q~hR`~W~=W~UW~X0*^|9ck<st83udwDwewāw؁wx@yhzEzz3{|8|`}|~z~ȃ~~0BMH?ɤЋ 7HUuЩ܌ fƯHphױX @ETp 9ԑn ش( DBȒJX xxз(P̚ @8ɹ|ӹ^dn,~Lإ4L 0H@ԨP,`pث|лԬ`D 6L`ǼѼ<ּۼ8Dt< P$@)3h8DTԿ,4-H-D-T-X. /dP//03436779$9:$=4>4`@t@@DW>WP?X?dYA$pBtpB$qCqCrCrHD$s\D4sDDtD4uEDuETuEduEtuE4v$Gtv@GvhGvG4wGz`H${H{$I|I$}I}K}K~0L4L$MTDMXMMMDMNNDOlOOOPP$PTPԅ8QLQxRSSS$Td@TԈTTDUV$W$LW4tWDWTWdWtXtI tJ8JpK4MDR 4TXTUDWd_T`b(4hdln\T(tD D<p<Dt4,D4\TttD4\$Td0X$lt$$8DpT4\4p($`$  l`D 4 $ \d!"D#T##4%zRx &D$4FJ w?:*3$"\@0tHFBA J  DBBA HBHB E(I0C8G 8A0A(B BBBA h8aFEE D(F0(A BBBPk0pLFBB E(A0D8Gm 8D0A(B BBBA LFBI B(A0A8GN 8D0A(B BBBA D+dxxԒ`OhA(DEAD Y AAA - < FBA D(G (D ABBE LLhdDFEJ E(A0F8D" 8A0A(B BBBA D'MYaL 0FRB B(K0A8J 8C0A(B BBBA \ARx (EAG  DAA   HHFEB B(D0D8DZ 8D0A(B BBBA 05p,P3FED  FBA UV 0 mFGA DPN  DABA [P(@pFGD@S DBA @0 "D{ $XDNHO ^NFAH0FBB B(A0A8Dpc 8A0A(B BBBA bpLBBE E(D0D8D^OIJEBM8XԷ 8A0A(B BBBA 8D?FAI$B DBA <<NBB A(D0c (D BBBA 0e=0(P|<FAD mAB|V2  Ԛ@E_ D R A H 89BG N EA LT BEE I(G0D8J 8D0A(B BBBA H ļHh DBBE B(G0H8G` 8D0A(B BBBA  D<` h  d D ` BIG B(A0A8GoVNB\D *& 8A0A(B BBBA ~YSADoF4 HBAD G  DABA  L BIB B(A0K8Q= 8A0A(B BBBA H "IHh 'BEB B(H0A8G`8A0A(B BBB N`0 oFBB B(D0A8D8 $f 8D0A(B BBBA 8D FIA D(G0r (A ABBA  0 p), l AC DIED A  ^ ( $<3FDD ZGB(  0@<FDD G0\  AABA tL 08FDA A(D0 (A ABBA 404@IEn E "8,phFBE A(B0J (D ABBA h5Fn4nFBG D(D0M(D ABBG[U$(iEEG0UAA 0!H(DFEB B(A0A8GP 8A0A(B BBBA t61P4 A(lFDF x ABA TBQ$?FDG `GBD  H\FEF E(D0A8Q` 8A0A(B BBBA ^`toF0(BDG DBA  kL4 FHB B(J0A8J2 8A0A(B BBBA W ,nBIH J@L AAB8&EY`L BEB B(A0A8Gw 8A0A(B BBBA  IFDNTU8t(YcADK0t AAA XuFBB B(A0D8GFeA8D0A(B BBB$$$8.EDA aAAL`LBEB B(D0C8Fd 8D0A(B BBBA -t AM AA D]BLI B(D0A8GP8J0H(D IBB0<'BBA J DBB<pBBB A(A0D@0A(A BBB,1@\0I(A BBB$̖:FGG [GBq AGB(Ė <LHPBBB E(A0A8GP 8A0A(B BBBI `P(SBAA J ABA   8wBEA D(G@X (A ABBA @@p\FBE B(A0A8L 8A0A(B BBBE )LIBONA4UGGGR$-DAAD {AA0 (H-BAA AB$t% A ABA .AD ^ AA Y 8ėwFBA A(G0[ (A ABBE 00 .4DHM8\ .FBA A(GP (I ABBE ,|\PT (A ABBA .#. @UfA .FGGH,/BBB B(A0D8A@V 8A0A(B BBBA x8@0(CBAK mAB(DSLAD s AAE //,P@/HT/BBB E(D0A8D`~ 8J0A(B BBBE L/` ̕DBN i EA 7>OX9$8! 8L+BBD D(G0O (D ABBE 0/;Eu,/(>(4/8FDA K ABA H,$(4/IBBE lMBP  DBBLp0/0(0/<0P0/d0x00p/00X/00@/0k1^1Q,1/@10T1#h1|1.11.11.112d.202xD2kxX2"8l2RBEB D(A0<(A BBB82PBEB D(A0:(A BBB42BAC f ABE HAB3P!JQ83U L3J"EVHh3PFBB B(A0A8Dz8A0A(B BBB3EQn(3EFDD sABH3.FBB H(A0D8G`8D0A(B BBBH4$\4FIE D(G@4XfpX4TAR4+JXD4BBI E(D0D8A@8A0A(B BBB$5o=EAD lAAD<5 BEE I(D0A8HP8A0A(B BBBH5G/BBB B(A0A8A@ 8D0F(B BBBH5*BBB B(A0A8G8D0A(B BBB6^MB L B,<6FEG D0 ABB(l6|ECJgAA6EQ(6FEC DGK' H6"PBB B(D0D8DPd8A0A(B BBB$,7T#/FDG NGDT7\#H@l7#7#ET7#7#7#@7$7$08 $(D84$BBB E(A0A8B@8A0A(B BBBH\8$UBEE B(A0D8G`08A0A(B BBB8%-08%zBLH JU AAB$8&&NBAD CAB9L&A[$49M&.AFD `AA$\9S&GAFD yAA$9r&-AFD _AA$9w&/AFD aAA9~&GF9v&JBa B d :&AQ`AD,:6'~BBE I(D0C8D@S8D0A(B BBBDt:l'BEI B(D0C8C@n8A0A(B BBB0:' BAA Dp AAB:(BEE E(D0A8GGGA[GGBf 8A0A(B BBBB D`B2KKA^KKBdDJB|DIAGSAL8A0A(B BBB ;y-E C O C 8;!.xBGJ G(D0O(D BBB$8<].4ADD hAA`<i.It<.D<.4<.`D<:/rBEE E(D0C8IH@8E0A(D BBBD<d/'EEH K(G0L8@U8A0C(B BBBH@=C0BMB B(A0C8G8A0A(B BBBH=3BBE B(A0E8G 8A0A(B BBB=Af[I=A7$>A1ADA ]LA`,>AuBJE I(A0A8DPQ 8A0A(B BBBE 8A0A(B BBB|>GBBB E(A0D8G3IDDN_EKAiBKAg8D0A(B BBB?IsYN E C0?hIBEE B(D0A8G(LDBIqJNAXJKA`JBABM[{KDADBXq8A0A(B BBB0?LFDD h DBE AAB@M"ES H A<@MiDP@jMFEE B(A0D8E@8D0A(B BBBH@*NBHB B(A0A8D8A0A(B BBBx@NBBE B(D0D8GMNBKPUAKOaAE8D0A(B BBB`AQxBBB B(A0A8GlJLGjGFBXTA(OYAS8A0A(B BBBlA^HBBB H(A0D8J;LRHIzCOAf8D0A(B BBB<`BaFGF A(D0D@0D(A BBBBb$BEB B(A0A8GBWB@BXBB`BBE_ABRABSCBSB{ERBlBRAEZAlBXDILBBDDGBBQJBBIDDGBBYfObBgHBBBDDGBBq BWAwB\A JIABB`8C0A(B BBBtDEFBB B(A0D8GBBBBGLLBBMX8A0A(B BBBPDFAD G@oHLPBXB`BhFpHxFECI@z CAB$LE3ELQ0uCA$tEELQ0uCAEBBE B(A0A8JcGDDNHITB2EZA`LSAyMBBAJ^}MBBXbJBBX8A0A(B BBBtF aBBB E(A0A8GRWBIRVAOGXAY 8A0A(B BBBB JGDVc8A0A(B BBBt GFBE E(D0D8G`ehKpRhB`ohKpQhA`f 8J0D(D DBBB Y8A0A(B BBBGaG9GGlFGtGA(HNFAD AB0H@B}LHРaA_hH8ErH1SMBAHHhFBB B(A0D8DP8A0A(B BBB(HjAAD aAA$I#AAG0AA4@IɪBAD v ABE DAB0xI_BAE } LBE ACBIIrAppIoBBB A(D0L (A BBBE F (A BBBE  (A BBBE m(A BBBHBAD D0x  JABE l AABKĶ8(KͶUBEE H(C03(D BBB\dKBBA D(D@ (A ABBE  (D ABBE Y(D ABB4KFAD  DBE DABHK,BBA D(D@@ (J ABBE q(A ABB(HLFAA AB$tL>AKD AAL0Hg$L;ACD pAA(L(BDE YAB M% M&84MBIE G(D0l(A BBBpMBMJ;MqMb MMD MyM% N|$N 8NDyLN$`N tNN NN N NN OO (O EDD jAA8b"FEE A(G0o(A BBB,c"@c#oUY E {`c#@Ez|c$AaX(c<$RAA AAAc$%(c$>MED \DB<d.FPB H(K0u (A BBBE @d$]0dd |d d @dLAG ] FAH XC I CAA dh$+ eIe I4eXHedEQdeh|ep5MU A e#.ex epe|EQ`eFFBE E(D0A8G`~ 8C0A(B BBBH j 8A0A(B BBBL 0`fluEDG@W AAG }FALfSFED D(G0a (A ABBG D(A ABBff g gEQfFIA iBEF C(i0EF DD A @ijFEB F(A0 (A BBBG j  0jDj(EQdj( xj$j0EQj0 j,j8EQj8 k4k@EQ QFD ]DAHА'PBG A(D0~ (D ABBK G (D ABBA '0'7_$D((7ELG YDAl@(Ej|(((&I\Hđ(dFED G(G0f (D ABBD J(D ABB((ET s FN Q DK <)FMX)Al$l*.FGG IGE* $*.FGG IGE@В *lFGA D0A  IABI P  DABA 8+ (4+Dl(<p+0FED XBBht+|p+Cd+70+EDG F DAE jAA(ؓ4,EAG@g AAJ 8,FBD A(D0X (D ABBF @L- <TH-FBE A(A0s (D BBBD 8-FBD A(D0 (D ABBG Д. $..FGG IGE . $ ..FGG IGE8H.FBD A(D0m (D ABBI (/PD`/ H\/|FBA C(G0B (A ABBE U(A ABBH/FBD A(F0C (D ABBA U(D ABB8l./ [<EAG@a AAH  AAE .0C<HI0O 0EG | AG ؖD1bHa G K E (1FDD0` DBD (T2 <P2<t/L2{;FBE G(G@j (D BBBA 4/2M;FFD H0a  DABA ,/$3';FDG0H DBA 43KAD xDBBP 03EU8L4KAD A DBI PP t4@Eb A 4EJ V AA Ș48FY A 5OEt A L5EU8P5KAD A DBI PP X5EV\15 9FBB A(D0D`f 0J(A BBBF  0D(A BBBA ԙx7t7Di47BFEE D(J0I(P BBB47H74\7GFEG D(G0Y(G ABB778К 88(8=FDK dAB$(8EV@,8EU\08p,8(8$8 8kH Q A țt8sH N A 48gBHD A(G0J(A ABB@9BDD r ABA T ABI u ABA `9eH N A 8|9FIA D(D0 (A ABBD D4;Y6FKD DPz  AABI T  GABE $5#6P4D5 4FAA x ABE Q ABD s ABA 7>S4FM>!$>K(8>FDK N ABJ d?x? ?? ? ȟ? ܟ?|?x? 0t?ECG0| AAC wAAL? `?t??&R?$\?Ġ@!ؠ$@+@@&\@&x@&(@&<@%@P@FBB A(A0D@_ 0A(A BBBI (AkEGG D AAG AԡAAAK,BZ$xB!8BFMTBhB|B B BB̢BBBB B0BDB XB lBB;B/FBB B(A0A8K@S 8A0A(B BBBJ K 8A0A(B BBBK  8A0A(B BBBE <<CS/HI4CHC <C;/\tD;\4D#UPD#U<lD3.T<D3.T=DC.d=DC.d8,EwFFD C(D0o (D ABBA 8LpEwFFD A(G0m (A ABBE EFM(EFDK N ABJ $ХlFxH [ E ] K O A $F.EIG SDA0 FTEDG a ADJ NADx>FG/-H[ E <t(GPBH A(A0 (A BBBG HȦHܦ H4\$LH4EMI SDAdHBg,H@H#F\$\H2EKI SDAH4I IDlcI FY$I4FDJ MJD@I3[TI7_hIEm(|0JTFEG \ EDE 8dJlFEG D(G0` (G DEBE JGlJJo KJo LKGl4KNvHKJo\LJo8p"eDP>eH>>'eL?(?eP??)eT @eXp@@e\@A%e`xAA edɃAeh8BelpBepBBetC0C"exCC!e|De hDD eDDeXEE#ecEF.eFF0eXGG&eGG%e 8HXHeH0CeICe2 Ie?BhII&eIJ a PJxJ!aNJekKexJaXKK"eKK!e LexLL'e MeۄXMeMeMeN@N+eNNe8O`O$e/OeOO!eJPPePP(e0QXQ"eQQ edHRhRa gReRR"e}@SeSeTe ΅HTe$Te(TT e,(Ue0hUe45Ua8"NVe<HVpVe@kVeD#HWxW*eHdX(X"eL2hXX ePXeT YHY&eXYYe\Z(Z a`XZedZZeh0[`[*el[[ ep\et`\\"ex8]`]e|]] e]^ed^^$ed_8_ e__e`(` eh``e`` edچPaeaa(e0bebe"bepcc(edHd)edd e@8eeee)e e(f-e xff%efgePgg*eghehh(edHipiedj(jehjj.ed kHk%edkledYhlelm!aHmxm'amm#e`nn e@Bnoe@BHohoe @Buoe@Boo"eppe q@qedqq1e 8ra$Xrxre(rr&e,@0s`s)e0ss-e4Xtt!e8u‡ 0 ͇w ߇yzssHw  ||H1}0u J~btHƈڈXut   H$ 1 <dF HQ_ (xy 0 0{͉{@߉(s(| | ,xu/{/25NuR(v{U<Xv }0[v^w@bPw@fxw }iwlorw| x|@xpxx| xx(yPy(yy  ƊɊyd̊y$ӊ0z$׊pz$ۊzފHHH {<z"?z0@THY0{0D_{ Hi{0BpH|L|pP|0T}"XH}h}"\} `ċ}dԋ~Ƕ9  `~ Bh5~0Bp/X 0x<Ep|`pBv( h""(&"p"nj""0X""""@h "Ѓ#"@`"Є"(H"Ѕ"/ "h+"F"0`-"`"!"z`0 "b@p0ҍ@0Bȉ  p" b1"E "Rfy9 0s( 0B 0؋0 00x0 Ȏ  ׎  `     $    ("  1h,B0S4d@8u"< "@"@(0D` 0Hȏ @L֏Ȑp  Ȑ BP0T0X`0# \6 `H( 0dTp hf0lp{ 0 ph t xɐؓ|ܐ 8"p0" ! 5E0_8 kp  ( p"đp ֑ؖ P"  0!    "1@ Ne 0s 00pȚ0ƒ0ؒ@ x 0 0 0 0&p @hD$r`b  o 0H"x   ! "00 #0˓hp1$0ԓ%0 &00'0  x(0$ p*)0200B(E+0,Wؠ,00kp.-0x0B4ȡ /0800<h0B@ 20DДpbHآ4"P5T06X.X7"480\E90`Z:0do ;hz0xp=<"@blh>p ?t@x͕ A|B0XC DE 6@F K G0WЦH&`IqXJ0K0L(MÖhNԖO P"@Q x R0&S9H>V bM b\0WnXX ȪY0 Z0p [0\"Ɨ]0͗0^"h_0`0`a0"'b0<c Td fe0{`f0 g0دh0i0ۘjXkl"m .n"$@0o(Up0_` q0,kr 0s04 t 8ř@ u0<љv@Ȳ9w009xp.93y"E9Vz"VH9{"g9|0| } Dh~ H L P00Tʚ0Xܚy9 0ȶ 0B\"` pd"h"8 l3hpKtbи xp "|{H0 йқHHx"00$@"- 0; "F YPp iP Bz м008 xӜ0ݜؽ0(x p 2D0 Rpd0v  `    0 " ̝h  ڝ0   H0 " "0  > "M" g`"w "$ 0( 0, 800 ˞`p0ܞ`0B4  08 0<   @ @ D 1x0H I0L \X0P q0T ( @h"X  b` "͟0bh 8 l h" h0bp t 0x H(0| Yp0m 0B 0 0 h  " ٠8" 0 " ) " Fp" _" w" p    0 H 0 ġ0 ա 0 0 P"  0   #(0" 4X ; M0 d ` p0   |x     " P 0 " Ģ " Ң8 x0    " 8p 2`"E`"a` ~0"$ "( ",  p0ԣ 0B0 H4 p"8 & "< C0@ [ 0D k "H ~@ 0L  "P  0"T X ¤Ѥ  \ 8p` 0d "h   l P p ,x t B0x H0B [0 k   v0 H0 (  `0   @ե @ {00  & `s  {~0jFj@Lp`O- HZ- Hg-  u- (- - @ - @ {h- |- |- -Ѧ- ަ- - < P? 3v= @* @ @8 ` O`C  `0@  E HhF$ sG H$ d Ƨ J$ ԧ d(  L$0 d8 " N$@ < dH KpQ P Y( @P hR@}T  T U$X 0V\ Ǩ`` ۨXd 'Yh  Z$l ([ =H \ p e`] t `x _ ` Xxa ©b ٩c d 8e xf !g` 7`h H`i [`j w`k ` m0 ʪXn@ Ӫo$  p hq$  r$  s /H` ? u K v W` w c x$ o@ 0 z@ h@@ |$ }$ ͫX~ @X X 0 @ +5p S 0@^ox`    ` 0 `  $ ɬ  ڬ`(0Hvy h`   "x< N   Z`0q(@zh  h ` `0`0`0` 0`%0ӭ`0`0 `0`00.`0`)08`0`` 0B`0`0[`0` 0o 0z @$ $( X$, Ǯ 0 Ю(4 h8  $@   D " @H @X  L N0^X o$P `@ @T  @X ů( @\ ݯx @`  @h P  l x$p  t - $x <$| OX a0$ tp$  8  ΰ ` ٰ$ ߰@0 x 0` / E@@@N T n H   ı0  ұ`     P  . B R  a@  nx ~  X  X ɲ0 ݲh    $ H$ /$ H$ e $ t p$ .u h ӳ``  ` !8  p"`  >0`$ u(Y ( r0 , p 0  4 `  8  < 8` @ ڴhD 0 ` '-@E@  @@P  @@\  @@g  H s  08  @x $L  `  0P  0T ʵ`  X ڵ  \   ` P p  d   h ( P  l   p   t %0 x Ax | X s` @(` " ζ# $ ` X& ) ' 7$(IW ) q   }H+ , - ɷ.$ /    0  X1 X2 3 4 5850R60@p70(` x9  : Ǹ ;$ d 0@h>$ ?  70@0NpA  `B pC D  E$0F Ź` ع H$(I$X` J J@% L>X N$ L O XX P eQ$y d S$x @ @ Ⱥ(@ܺpW Y0Z [ 2\$F0 ]$(Uh^ ,i_$0p`$4( a$8b$<c$@dDû `ջ f H Lh P( i T` jX @&l\A m`XP ndo o@h o@p8!qxX! @! @˼! t@ڼ" @@" @"@" x$|#y$/8#z$J{ Zh#;| n}(u~h}#$  $(   ۽@$$$$@1$ E% a8%q% $% ξ%@@& &@&'@!@' @.'$7'L($]`($(($p`)``)@)$*0@ѿh* **(`@+p+,`+,,@18, @>h, $K,$TX g, $v-$`-$-$` - $- $ .$P.$x.$.$  .$&8/$0p/$F` Y/$c/d t0$$X0$(0 d,0$01$4@1 `811"$<22$$@3@D4$H@4 $L$P(4T@4 XX4 \m05 `  x5 d55  h@6`6 @6 l6 @7 p70t47 xI(8 $|Xd|h$8Hx$8d9$: p::  `  ;$0;$3X CZ$v: P;$x; $; ;`X  <` h<  < <`u(=tp=@=0@*0>@1h> $>>@W> `e(?@~`?0@?@@@P@  x@ @ @ 0A xA`/A @@>HB N @_xB x  B @B C  PC @C  C $$C$ B8D$$YhD 0(i 0s 0 0  @ D ,D 0 E L`E4 E$8 <- ?E  @M F@DapFHxFLGP@GTGXG\H`XH `d!HH !hI"$hHI@@$$l4I %@pCI&xL J '|ZHJ( kxJ )$vJ ` `+ J,$ K-$X. PK /K 0$K dL 2#3$=8L4dYhL5 m 60xL70 8$L 9$M :$8M ; hM`$M> BvN> `N?N@$ N ` %` ?0OC UxOD@fO @u0OF OG@(PH$PPI$P JPK 0QL0`QM  QN Q O ,QP A(R `PxR`iR`pST S`HT T`U` PUY$(U`0V[$85HV\ <FpV`@'^V`D(pHW _ H~W `Xa L0XbP c XX ` X eTXX XX YX HY\ pY\.Y\>Y l`LYm$d^0Zn hthZlZlZ qp [r$tP[s$`t u@x[v$x[w$| [d)0\P\y$%\z$9\{I]|``]} g] ~(t]0^$X x^^"$ @_$@_`p_!(_`_ ``-H`` ``!(BN hga$paa$a$b$0b$Xb$b$b$ b $ c$6`c$Hc$dc$zc$0dddde`He$X e$e$'f$98fMf$_X ef$g0g!$ xgg$|g$h$@h ` h (i ,@i 00i  4i $8 8j$< xj @,j$D=j0HP(k 7L^Hk $PmkdT3 l$X`l \l$` $dl $hl  l  m$pPm$t7  Bm $xQm $|^n @*lXn {xn;  n d o$  o` o` (p$Xp$p$9p$R(q d,axq oq wq $$X 8r$`r  r  s$HsV9  3Hs `/Hs@Xs h8t  v`t `pt@e (u @ @hu @u u! 4 v $CHv Xv  fv |w `2w$w$0@w0@xx  x@ y@ Py@y@2y@Ez@W z@hXz$xz$z ${$@{ $h{$X {${$ X { $ | $*X|$@x| $K|$ [| $$|} $(f`} $,} $0`  } $4}$8: (~$<X~$@~ $D ~dH:$LMh $P\ $Tg $Xr $\X  ($`h $d$hȀ $l $pX  X! ("$t,#$xJX $$|U`% n&$X` ($)$8 *h+  ,@-$.3 /$BX0 ^1$z@20H37L4$5$6 7 P 9( 8(" :(/; CR <$m=$0X >$?$Ѕ@$0wvBA d3 C oD( E$` @@G H 5@ `0CJ$I( K U(L eȈ`4v N   O XP Q@R$X ST  0@VtЊWHhY$Z$ ([ X\ `6^ P  _\ph_e`Hr`b(،`c(X`d(X`e(X`f(X`g(` h( X`i($`khj{h((j(,hj(,` 0Ў`oh ` w(4P` q8(`r(<ȏ`s(@8(`H>PtE`@Kv x(4Y` p(4d`y(Dz(` z(H``|h{hȑ`}(L` ~(P8`(T``(X`"(X`h`h jhX`(`h|ȓ\ } |@|0x @` ||0&P `h3<ؕ }D }NX }W 0d0w{@0p00 p00 _0<DUȗ au(P X0 P%0@0 PtP 'xP: PIؙ PX j0 8up 8 8xPP00@8 ` 8 8'p 8 4 0Cx 0N 0Yx 0 d 0@ox0y 0x 0 0 0 0 0 8@0@80@0!x P0G TpZ 8e 0ry08PHTP08(p8108IRH PaPs0 y(0@` ЪPH 0PΊR 00S`0'U:D GЬ PU8[88 dpl vȭP XPȮ@pPzz (8@`P3E^oذ00H PP ( 0H 8x 8 0 &` , ;BV8^`8gp    0@0  "H0+ 5 8?!0E"0N Ax$#^P&uP$  &0`'0(8 )*8 (+0,0 `-@Pȸ/0$` / P(:@3^40@d50k@ 68@w78}8090P: ;<0л=0>H?00 A0@B0 HC0@D +ؽF03EG(HP [P(оP0x0P8+ L<XP@.NO0( PD1PQ R8  PH!TPP>G]V8e0W8ly PhY Z0 [ (\8` ]8^8 0`0a0b0 5@ c0@^8d0gjh X~~u}+   x xt|`rh lÇ0 ·8 p hitHx2KcuHLjۈ /M Zc @jmwH0~p   H   H  "4D` S`j@|% y  0 X     H  H ( 3<ENW(`xixr{   P   x     `   , 9 F S `x k v  (     x(` 1C O-@2XyH[k 0{ @ 0h (s @0 <vuE\ \ # 1 < J J TɊ`ag am<u< 9 vuvui| @Hy||YP}b}]ypVv@ 08yP.y08P./yyyyyyyyyyyy\ [ @[ Z  !7AKU  afgogf    ==! 9 9 9 9 xw9 9 9 9 AA9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 : : 9 9  :  :  : 9 #: 9 : : 7 7 -: -: 7: 7: A: A: L: L: Q: Q: Z: Z: 5 5 F8 I8 L8 9 O8 7 7 9 7 ^R8 [8 ^8 h8 R8 hk8 6  v8 Wy8 |8 ~8 8 8 8 8 8 8 8 8 8 9 8 8 8 8 7 8 ^8 8 8 8 8 8 8 8 7 8 7 8 7 8 7 xG9 P5 8 ;9 9 8 8 q8 8 8 8  v8 8 9 9  9 x8 9 9  9 9 Q9  9 b9 9 ދ9 !9 $9 '9 *9 -9 09 w39 69 ~ww :9 6 K=9 @9 C9 F9 J9 M9 (^9 p`9 c9 f9 p9 f9 s9 v9 9 09 9 9 b7 9 9 r   H h   , @ H P& Q9 RN Sa Tw U V W X ` h p x   * ? U k |         "# 2 @ N b t         tiia7 7 7 b7 7 7 s7 : F7 i7 : 18 o8 ; 18 d)8 @; 278 tiia7 7 7 b7 7 7 s7 : F7 i7 : 18 o8 ; 18 d)8 @; 278 F8 I8 L8 9 O8 7 7 9 7 ^R8 [8 ^8 h8 R8 hk8 6  v8 Wy8 |8 ~8 8 8 8 8 8 8 8 8 8 9 8 8 8 8 7 8 ^8 8 8 8 8 8 8 8 7 8 7 8 7 8 7 xG9 P5 8 ;9 9 8 8 q8 8 8 8  v8 8 9 9  9 x8 9 9  9 9 Q9  9 b9 9 ދ9 !9 $9 '9 *9 -9 09 w39 69 ~ww :9 6 K=9 @9 C9 F9 J9 M9 (^9 p`9 c9 f9 p9 f9 s9 v9 9 09 9 9 b7 9 9 9 9 9 9 xw9 9 9 9 AA9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 : : 9 9  :  :  : 9 #: 9 : : 7 7 -: -: 7: 7: A: A: L: L: Q: Q: Z: Z: 5 5 h  h @ @  ( h 0P h  h  @ h H @`0h h h  `h  h @ p ` p(  h  (  (    ( h  h  ؇ h  ؇ h @ ؇ h ` ؇ h  h  P h  P h  P ؇ P  0 Pp8 P ph   0  d J 8J o8  (  (h ooooo$ 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p ./<| >r>r = >!  ' 5? H T `j   6stapsdt> libstdcxxthrow8@%rdi 8@%rsi8stapsdt> libstdcxxrethrow8@%rdx 8@%rax:stapsdt> libstdcxxcatch8@%r8 8@-80(%rbx)4stapsdt9> libgccunwind8@%rdi 8@%rsiGA$3a1dGA$3a1P1dlto-wrapper-11.5.0-5.el9_5.alma.1.x86_64.debug=7zXZִF!t//Kv]?Eh=(aK"`¹O ɏӖE\v0m׬9 ƿ4v@mK4ՓDcnMZ".cOUXtN7SH&މYYUWF=<&.}cF%ˮжt/ݏ.Ltt@\쑙c*njsh %^mQQM}o'e,X 6 `h\SQ]Z% ޡ%,2g5y2hg|s{q 0p%%_Txa' k_M˄1Gjb2  .hb9D}-e!uX GAJe5"7,͋4cRT_YO`PciFLTWMEncq,׬lvXXܥމwnM}P WUFʐ€m@g lVZҠ + 4c#lPSEGdG'lDgfKR_rFU^4j7E̱2D2Kmx1Nݪ ũǦ};sJ3 l)Nמư.r2t}"LJpOʝsPzq?ncTZWjCm38FkYڄ>`|^᱆ߜsBrLTV[\n wqP\ h S|z):{-xte TTeT>z*sV>3 ЀC+ GTw1G^S7dv28xˎhf#PZѷqrL PTx܁%G$8i[y}2h/F@)V5G|j]&# H`I* 3-kh_>Lzghz3v{ upF16;P^>im %Tj^vB߹s5 nflճYS_e o#3#8kG/ũVed=s^➔6Ş<\F/KXݦ2@R1FQ( T_xҟɟч>MVV4F4I!00r9LPB"n%ܑ=:~m7ګ]N2T&OhJ.|w-,#F#|`H d!#T"1C-AK*$Mv%=o bswi},"MlIߤLr/!y^\צjD/㷉.BaeCFoՌuq6]0z0ϚL82<0lik\VfBu9 $^j饇 =*чC$.l?͔c)Y׬)S<3XvirLRBl&iޟW+'ƾE#A)%Ou'R!(1ٍ=>j'p%_h(r4JeVh.)@!=vR?LmB@L" >:n[bMS YC(An({9k?4˪YgJkT;,K"(W\<'3M5i;$#q!tʯ.bjȡxMCM$l^eBӪݖ=eM8X~F=,6VH ٦ V`v~QP+Ł`/c$A̼K})i{ F_2P#.Hk:~%I/^e$}I Ӕ"iN-#uev*l(GɥmPCMѵ 8ziW{jEu7X Q{8em+se`nX[r1T @E^V(u64`&Suje\XޥXuP<*{*1 h@֌!6 ”^S1D-~ G};ճC9~U:njʪ[k?лċ 5[ a؅}ԙ{KpB%Ǿ[HAa쓆1ðݺ8 98!a<æAbNظ=geQZ_>須aoxbdz%4FgoKi-S /fV/-r>3Qᇑ<.5Afs7|{ݬȅ4_]:q;\`Ca;/E:a(tE+mX|ˍ5Z{~ OMI%b΅9q\,2nPyj5P"lK%ex o^?EJ/sɫU D1`WefOTg)RyϔosQݕ9%Ԝ !7"}$4U7r #" Հx^0 A&eDK[l&/t*FCN^#Wp M*rS3iduqd.Mmw>50/iu^W%\q LLEq [P1ILEk:|-HӰs D_7iW56~\4OjtD&K̬AГ2K!sX}(*l/ؕU5~R69t"MS1aEAU˗粑s4]%`$ 1ڋ A&ԙr T+ }i"pi(ɜ:uxQvT.O˨t7Z^Q82-=-L$:NJ8I :Ʉa ncY7#Qs",Q ^zߌjv{ (+y%J{{ӒWu.crX&Hz0BӢF&_j|_qs<D%]N9c!#oʅ^DLBrr4}ǮOA,b@GqkLHByTdގBZkj#5_O,- &K;4):3L)QX߼˙(^o1p &fk~C,S[B2ְ)syPٽ,f6`i0":cAfn9@Evxky!)•Qf<a%{Oz<-RPD*Oڢ)|27Ie6J +Sr/<^[vK=#=gy}Ra$gLX hT&|3e -[17;5QnvTwpEڭG#,\ O)=pȢuo"q" զ;ΊZ:89"%?@|A476aNrP,-gZɆGJhii,' w*;443,KixG5##mtZP?k8 ۫O7#s T^ꖬ|.oX'QK:gc^vz'UiԄPbũ}CpY~P}$ %s;ȶ~ Opd^W Lu) AiӟHA9 &pQ7'mu 4d\) FԞ'uE/B)@ح?IW~ڟau$l+k"Vk#J/y lǛSjmtbĭrTx,0Rb 6[&p27j︳`^Ir /M!QZdt&ܙ?1MRo#pG[- [lEPq Jtm[E/}3=Jj>;v=>˃DZ6GJ7e{󘪛R)eN<t9|0ay1}dϷ`ן57bľ\&X+ˮt |O%uD`B69CRU+ ?NogN9߽@~H aT@l|}Mi} ^ <԰&׻{@SzrӤ͝7T0[>@omQ{56:`@@TYVoD6 xax,8gr&G+Y+a@M()w~$XLcѡJwά0$Vh߫˭>N MO TO& V ,Z>҈hԂFɐwxs[$2H2F$#pۙ_fщJ(lwSa$Kؕ f4Dc L JWvіe1$|fP9xEw ؋_:ŲFzQOwA d«no%pU[pP\ Q v@^9R_i_3[/0\;-b 3`!#EcX5ܮN.2 l8U \JR ik[h %7:E)\'@N|J8kҖHM| uS&hdb^ӥaK!Lɿ$_HC: ˄3cU.+ȪNnmIMkC/)PT/I=+.ÎcArL\W(mח 6]%1s0f7ݮz|`Y|if&Ɇco)m;>ws3KdAj s7.C>>nWqS\.s|n,X[N yD \'Fq(0rwP`$4% U?CF̩RR#~bQ cV#m['&):9^"$9[Wn̛r3]f9~!FjoblYb(#Ŋ3hD))TJ__?&93dS㇯1:|s~1g,3YCW6y$i#IJiK ʕdײ@_E U MLhDøv[rsSbe1l9;3nͣ0% !dj# }ht( ])q*-VF9*cw6SQĤ͡G0Ҙ EB) {"͌yHB)ic(T_h]|oGWb? Cl`ߔugtF6`$"#h͇] ^2{{0u2*vJ"F4@!;A#i%S[۷~0B>ASƂiWn)-x+CA/'91GɕU78xh9`${Wdhۅvjk?fY,ObQB\&UlOUK3wŠ(5iG&]uzAX!N(Cki;5/vdz:?H4r~D.bǹ#3Cfq?0Cʵ}Zu+&sD CZ@)b*̰3n~]38"FIa`m6$yB{3[n]: sKM4U/O5ZJF`k U+ZBn)G{^b _IzPV jλ,HGt+Z3ҥ ă)Lq KMqrPLmNJɟeaᤞwF90o;b20dQCzGf $)j-~1K=F ; 8{Ϸ`*+~bLºXe>Rsa'oo؃F8Ӧ ^5a k 4ſdb,ݰ_M "Eհje^ց23lX7o#>Ԇ'fZu5IS$M [<|HK nRH XE@"?\h3);}KkS5ᾧ oq>[\c>v&Z~]Ra<^:P5|w;o\ /F_tۮ ]zLTN@WbEO…F^g@b˃Uzh;1B):HS_Ca,pɿ%]?NuByjrd ^SզP"C p- \1#+_FFXx;!ʧr{Q8vP\4J?px MOun-̼Gv2*79\7dvy{g˯J.ܬd= wMla(bkgܮ>?hu<쥑|f싀FH=:4yX䉷+N7_hֆp_q1*#5\ ;lx N.U.^ދޙ+KRȏ'c[5(+R ~6_gW؂8MI/hD!=VKp:.>3:'e-NS45{>tg!~ LYbs{, d7\`^9yR8 E\ _0~YOS8!;+4R:&*Gsɗt]8n㚦s'͑9>"&b3ŜF)0ś zE `62+Zj@m/ =j\T,H0' 2}Z{nی(OQҺġh@{o]=J{NB ?tWw:V˘]\qqLw.e_` j9cW rO\!eXO,,Fk{5~hk9A a 3»;^:c$ T>eburD|YxܭQLr!68cUjbaM?|eU[~Cbn)ucuhVre}Y\]J -*Dw̗p~3lUE4z6it*]BR*,mKt44#gU! ,GQ$1o˫^ղ&v9Ύ5_`@3߯B!lhKfA98h="e F5?^9O(TPЧ2+8k E իL*ў)՚x:n {-qL ꇜH7b!SwB'n%Kl;" ~ 7\I)kB%7lY,Y8sfYZK>G[|E+3l4;.]fN g_z䩤!F9N[!JrH;@>ֲ3a%"v^a& +mvr <9#z*!hy衿²&ҕC!X'Z2s)IL|=HSZ8sC~U[xt}ڔAf$^P+?+Y|!Z{wy\:NZEFe!=]xf)R*.@$n44=߳QjJ㽆?BS 5i"JA:.L'ʛwYS{HZg("ѯ-Wl;iw5d'`({Ѽr {$+8v(?&MZ6V-ef H[_=lB:5X`wHj`j5*gW[6DE%˴T-&Ys2S)d H qWUSGozuvv*YGqb[O2U#>^~[e5Qk@+Pl^/~4ՓE;oXSP4ÉZpwFi=t d3|*rZve.<\F6T7UyFO}Q۝a惜2kBxuKP[CyHmdE1/T 54b֌6RZ*m|1ҤjM iۡiTf`r\72e_c,=0d5&c^Nm9?<2/7+CçVI'jeƀ"TuJWf|V@A&K$ 9n%qkFJd},h^f9n9=~S;G 1G]C\«I13Τ{?Yݓ"PTCK*]~Hu ĎeHWPwt,o+"]Wi4'ij|(l[n /|%mMre"<Y@nj Q;XoTdgbr:u=\Ug,7MyZ> \D.S}KEK#"NjHPC#&:u"7Vcm2 ˮEh|*TW?+˻VT>b×m,gy3ҰW/Y?(4!JjKZMw(yT4Xgf&˦j-1tB;w,"Su1^)%IvMqw^;f inF 8c0k($-AMtiqQ3%%o5I6̌*$eťoLyM"F#U@hd;@CU k)v oQP~0?1՚+%q[8m*y{D<{:y P ^hT<|Md[ޅn }p+CdX bJOe=7N/_ljw29 ;.+ }d }σ G5R߫V!l\!#FkmHf :r9+t i%{&i]5OZ:Ue1a+X5EZ,kA4 ++1rG. :?BH%,w.q'7Au[Nc߾Aq}?1:"\Ml`k+ &A.27JhxM?ݓz7fj m7xqK׷o S0-5/]׆w׽J=_=pq˺p@`F$Y ̽y[_drJ>3@|=AS2p3~ĥGϼNNtr=4n_-]Ӆғa5 T~_wq9(Wvv tokT+JUD,"Qz}X sdjjF/ζ889ATaTyFY៎TGU[cR#/) +./}$کOyd1[8mWҔۡ7q{xt,Ӝ:s;н.}i3}ZɈpEw%䖷̖c\E﮴[$yV/=qh&ZlaX V,Ī}]0Y t|rʉy@q7$n.-K iM !O>\^ȔJw8Yn6HM]p 1Ka$ul|s8UqKq |qB[Bֻ=[u.4fD{ґ&Tw! jlh.|uJ!B~ȟRazĕ6Pjk% ͂Y}+3 MPiZEކ/ERKw0>*G+nu0 ֈGr܉AN#aAFvlΔJzɗ8fJ Ijua}bۡ$Y'"^%vF]a]OMkC殮Y% ԣG2b*|iVc8h-9+~^H#5/(x 7KAd )9KCH _\*:l}E^@_i;γ4 :L~YH~ReTD4/o5΁l+aR -}\zgx p ENa p˂[Pz Z-urn>G*3p>"dcTZWN y2zбS(X%̦Uĝ*q+edۉ+̐^XH,2ٮ_{i ͡_)C!?҉c.Y6ּ]ֱhZTQo ^ & ((7. շ۱yk"7‡$EsՃ&]BO'$RиcXPXXUYuN\=q%k3 j}z޴s6wcLUr"l}4FzfS,/(<,[ְOqfҘ0cf;gYZ.shstrtab.interp.note.gnu.property.note.gnu.build-id.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.stapsdt.base.eh_frame_hdr.eh_frame.gcc_except_table.tbss.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.note.stapsdt.gnu.build.attributes.gnu_debuglink.gnu_debugdata PPpp0&$9 GoPQ 88 Yaono}hB((   Gdd pp > > > > *Pi Pi 88 8 y J J  J J 8J 8J  @J @J ?    ( ( %  +  0 0> HTh 4c KT r